RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G605060
Reference: TK1151 Chr: Chr01 Coordinates: 152466246-152466686 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

441 bp · TkA01G605060|TK1151|cDNA

ATGACGGTGAAAAGAAATCTAGAAGATGACACAGAGATCGAGAACATGGCCATGGCGAACTGCTTAATGCTACTCTCTCGTGTCGGGAAATCTGAATCTGCAACCCGACTGTTTCATTGCAAGACCTGCAACAAGCCGTTTCAGTCGTTCCAAGCACTCGGTGGCCACAGCGCCAGCCATAAACGGACGAAATTGAACGATGAATTGAATCAATCGCCGCCGAAGCCCAAGACGCATGAGTGCTCGGTTTGTGGACAGGA...

CDS

Download CDS FASTA

441 bp · TkA01G605060|TK1151|CDS

ATGACGGTGAAAAGAAATCTAGAAGATGACACAGAGATCGAGAACATGGCCATGGCGAACTGCTTAATGCTACTCTCTCGTGTCGGGAAATCTGAATCTGCAACCCGACTGTTTCATTGCAAGACCTGCAACAAGCCGTTTCAGTCGTTCCAAGCACTCGGTGGCCACAGCGCCAGCCATAAACGGACGAAATTGAACGATGAATTGAATCAATCGCCGCCGAAGCCCAAGACGCATGAGTGCTCGGTTTGTGGACAGGA...

Protein

Download Protein FASTA

146 aa · TkA01G605060|TK1151|PROTEIN

MTVKRNLEDDTEIENMAMANCLMLLSRVGKSESATRLFHCKTCNKPFQSFQALGGHSASHKRTKLNDELNQSPPKPKTHECSVCGQEFAIGQALGGHMRRHRDDATGKTIQTAVIKKQSGSGIRGLCLDLNLTPYENDLKLWPVVM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G605060
TK1151 IDTkA01G605060
OH-1004 IDLXL04_000524
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.600
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G605060
LocationChr01:152466246-152466686 (-)
DescriptionSimilar to ZAT11: Zinc finger protein ZAT11
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g37430 Probable transcription factor that may be involved in stress responses. No verified direct reference in this release
At5g59820 Transcriptional repressor involved in light acclimation, cold and oxidative stress responses.
A zinc finger protein RHL41 mediates the light acclimatization response in Arabidopsis.2000 · DOI: 10.1046/j.1365-313x.2000.00864.x
The zinc finger protein Zat12 is required for cytosolic ascorbate peroxidase 1 expression during oxidative stress in Arabidopsis.2004 · DOI: 10.1074/jbc.m313350200
Roles of the CBF2 and ZAT12 transcription factors in configuring the low temperature transcriptome of Arabidopsis.2005 · DOI: 10.1111/j.1365-313x.2004.02288.x
The zinc-finger protein Zat12 plays a central role in reactive oxygen and abiotic stress signaling in Arabidopsis.2005 · DOI: 10.1104/pp.105.068254
At3g46080 Probable transcription factor that may be involved in stress responses. No verified direct reference in this release
At3g46090 Probable transcription factor involved in oxidative stress response.
The zinc finger protein Zat12 is required for cytosolic ascorbate peroxidase 1 expression during oxidative stress in Arabidopsis.2004 · DOI: 10.1074/jbc.m313350200
At3g53600 Transcription factor involved in stress responses (Probable).
The Arabidopsis Cys2/His2 zinc finger transcription factor ZAT18 is a positive regulator of plant tolerance to drought stress.2017 · DOI: 10.1093/jxb/erx157

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_000524 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006950 response to stress Biological Process
GO:0006970 response to osmotic stress Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0009408 response to heat Biological Process
GO:0009409 response to cold Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009611 response to wounding Biological Process
GO:0009617 response to bacterium Biological Process
GO:0009631 cold acclimation Biological Process
KEGG gene cross-reference
ath:AT2G37430
ath:AT3G46080
ath:AT3G46090
ath:AT3G53600
ath:AT5G59820
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.980
Rank 1 · TkA01G605060 · TK1151
Cytoplasm0.072
Rank 2 · TkA01G605060 · TK1151
Cell membrane0.018
Rank 3 · TkA01G605060 · TK1151
Endoplasmic reticulum0.010
Rank 4 · TkA01G605060 · TK1151
Plastid0.008
Rank 5 · TkA01G605060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18868zf-C2H2_3rep15-58 aa
PF26040Zn_ribbon_CLPX_N21-47 aa
PF02150Zn_ribbon_RPB923-44 aa
PF24859FdhE_central27-45 aa
PF27966ZNF42830-63 aa
PF03107C1_232-50 aa
PF23451Zn_ribbon_PaaD32-50 aa
PF01096Zn_ribbon_TFIIS32-47 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G605060PF18868zf-C2H2_3rep15580.1713.2
TkA01G605060PF26040Zn_ribbon_CLPX_N21470.04414.3
TkA01G605060PF02150Zn_ribbon_RPB923440.0913.4
TkA01G605060PF24859FdhE_central27450.1413.0
TkA01G605060PF27966ZNF42830630.0215.8
TkA01G605060PF03107C1_232500.02215.8
TkA01G605060PF23451Zn_ribbon_PaaD32500.04314.2
TkA01G605060PF01096Zn_ribbon_TFIIS32470.1113.1
TkA01G605060PF30902CHAMP1_N33430.1512.5
TkA01G605060PF24071Phage_zn_bind_333572.19.1
TkA01G605060PF27771zf_MP8134570.01315.6
TkA01G605060PF12756zf-C2H2_236710.0005820.8
TkA01G605060PF13912zf-C2H2_638624.9e-2174.9
TkA01G605060PF13894zf-C2H2_438602.9e-0731.3
TkA01G605060PF00096zf-C2H238600.0007420.6
TkA01G605060PF09723Zn_ribbon_838540.00717.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SLD4Arabidopsis thalianasp|Q9SLD4|ZAT11_ARATH Zinc finger protein ZAT1148.400%Swiss-ProtMedium
Q42410Arabidopsis thalianasp|Q42410|ZAT12_ARATH Zinc finger protein ZAT1249.700%Swiss-ProtMedium
Q9LX85Arabidopsis thalianasp|Q9LX85|ZAT8_ARATH Zinc finger protein ZAT857.100%Swiss-ProtLow
Q42453Arabidopsis thalianasp|Q42453|ZAT7_ARATH Zinc finger protein ZAT754.200%Swiss-ProtLow
Q9LFG0Arabidopsis thalianasp|Q9LFG0|ZAT18_ARATH Zinc finger protein ZAT1844.000%Swiss-ProtMedium

JBrowse

View in Genome Browser