TkA01G602250 | RubberDandelionOmics

Gene overview

TkA01G602250

Reference: TK1151 Chr: Chr01 Coordinates: 151732681-151737462 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3904 bp · TkA01G602250|TK1151|cDNA

CTCCAAAAATAGAAACCCAAGATTTACTTGATTTTCTCAACGAAATTTAGCGAAGTTACTGTGTTGAGTCATTCTTACATGAAGCAGTTGAAAACAAAACCCTAAAAAGGGTTCTCAGTAAGAACCATTTCGCCGCCTGATTAACCTCTTCTCTCCACTCTTACCTTTCTTGATATAACTCGAACAAACCCTCATCACTACTATCACTCTTCTTTCGCCTCTATCTTTCGCAGTTTTTTGCAACCCTCTCCTTTAAACTC...

CDS

Download CDS FASTA

738 bp · TkA01G602250|TK1151|CDS

ATGTCGGGCGGTAACCTAAACCTGCCGCCGCTTTTCGAAACCGCCGCCGCGATGGCGTTCCCCGGAATGGAATCGAGGTTCGGAATGGAATCGAACAGAGTCGGTGGAATTGACCCGATGTATCTTCAGTATTTGAGAACAGCGGAATATGCTGCTCAGATAGCTGCCATGAATGATGTGGGTCCCGATAATAGAAACAGTTACTTGAACAATTCGTATACGGATTTGCTTCAAAAAGCGTATCTTCAAAGTCTGTCTGT...

Protein

Download Protein FASTA

245 aa · TkA01G602250|TK1151|PROTEIN

MSGGNLNLPPLFETAAAMAFPGMESRFGMESNRVGGIDPMYLQYLRTAEYAAQIAAMNDVGPDNRNSYLNNSYTDLLQKAYLQSLSVSSPQKYPYGGKSSSPNPNHHGYYGNNNNSNHGYGMGVGMGMGLSYPGSPLISPVPNSPRGPGSPIRLGELGTRFSPQMRNLGGGGGGVMGPWHLDGGGGGDGSFVSSLLEEFKSNKTKSFELSEITGHVVEFSADQYGSRFIQQKLETATTEEKNNGF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G602250`
TK1151 ID	TkA01G602250
OH-1004 ID	LXL04_000573
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.500
Protein coverage (%)	TK1151 98.367 / OH-1004 25.107 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G602250

Location Chr01:151732681-151737462 (+)

Description Similar to APUM1: Pumilio homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29200`	Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs.	No verified direct reference in this release
`At2g29140`	Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs.	No verified direct reference in this release
`At2g29190`	Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs.	No verified direct reference in this release
`At3g10360`	Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs.	No verified direct reference in this release
`At3g20250`	Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000573 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006417 regulation of translation Biological Process

GO:0010608 post-transcriptional regulation of gene expression Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0003730 mRNA 3'-UTR binding Molecular Function

KEGG gene cross-reference

ath:AT2G29140

ath:AT2G29190

ath:AT2G29200

ath:AT3G10360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.742

Rank 1 · TkA01G602250 · TK1151

Cytoplasm0.347

Rank 2 · TkA01G602250 · TK1151

Cell membrane0.052

Rank 3 · TkA01G602250 · TK1151

Endoplasmic reticulum0.033

Rank 4 · TkA01G602250 · TK1151

Lysosome / Vacuole0.017

Rank 5 · TkA01G602250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07990NABP6-27 aa

PF07990NABP37-210 aa

PF00806PUF215-242 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G602250	`PF07990`	NABP	6	27	8.6e-49	167.7
TkA01G602250	`PF07990`	NABP	37	210	8.6e-49	167.7
TkA01G602250	`PF00806`	PUF	215	242	7.6e-09	35.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZW07`	Arabidopsis thaliana	sp\|Q9ZW07\|PUM1_ARATH Pumilio homolog 1	42.400%	Swiss-Prot	Medium
`Q9ZW02`	Arabidopsis thaliana	sp\|Q9ZW02\|PUM3_ARATH Pumilio homolog 3	41.900%	Swiss-Prot	Medium
`Q9ZW06`	Arabidopsis thaliana	sp\|Q9ZW06\|PUM2_ARATH Pumilio homolog 2	41.600%	Swiss-Prot	Medium
`Q9SS47`	Arabidopsis thaliana	sp\|Q9SS47\|PUM4_ARATH Pumilio homolog 4	67.100%	Swiss-Prot	Low
`Q9LJX4`	Arabidopsis thaliana	sp\|Q9LJX4\|PUM5_ARATH Pumilio homolog 5	47.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card