TkA01G599520 | RubberDandelionOmics

Gene overview

TkA01G599520

Reference: TK1151 Chr: Chr01 Coordinates: 150988285-150990745 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

369 bp · TkA01G599520|TK1151|cDNA

ATGTCTTTCTCGGACCTTAGTCGGTCGTCTTCTATGCGTCTTAATCAAGACATTCAGAGCTTCGGGCCTGATTTGTTTGATTTTATATTGAGCGAGCTCCGAGCTGTAACTCAGAATTTCTCGAGTAATTTCTTGCTGGGTGAAGGAGGGTTCGGGAAGGTGCACAAGGGTTATGTCGATGAAAGCATGAGAGCGGGATTGAAAGCTCAACCCGTTGCTGTTAAGCTTCTTGATATTGAAGGATTACAGGGTCATCGAGA...

CDS

Download CDS FASTA

369 bp · TkA01G599520|TK1151|CDS

ATGTCTTTCTCGGACCTTAGTCGGTCGTCTTCTATGCGTCTTAATCAAGACATTCAGAGCTTCGGGCCTGATTTGTTTGATTTTATATTGAGCGAGCTCCGAGCTGTAACTCAGAATTTCTCGAGTAATTTCTTGCTGGGTGAAGGAGGGTTCGGGAAGGTGCACAAGGGTTATGTCGATGAAAGCATGAGAGCGGGATTGAAAGCTCAACCCGTTGCTGTTAAGCTTCTTGATATTGAAGGATTACAGGGTCATCGAGA...

Protein

Download Protein FASTA

122 aa · TkA01G599520|TK1151|PROTEIN

MSFSDLSRSSSMRLNQDIQSFGPDLFDFILSELRAVTQNFSSNFLLGEGGFGKVHKGYVDESMRAGLKAQPVAVKLLDIEGLQGHREWLITRSTEKLREVEGGSFSEGSADRRSSGDRNPAV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G599520`
TK1151 ID	TkA01G599520
OH-1004 ID	LXL04_000612
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.180 / OH-1004 75.155 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G599520

Location Chr01:150988285-150990745 (+)

Description Similar to PBL15: Probable serine/threonine-protein kinase PBL15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61590`	May be involved in plant defense signaling.	No verified direct reference in this release
`At2g05940`	Serine/threonine-protein kinase involved in disease resistance.	xopAC-triggered immunity against Xanthomonas depends on Arabidopsis receptor-like cytoplasmic kinase genes PBL2 and RIPK.2013 · DOI: 10.1371/journal.pone.0073469 Pseudomonas syringae Effector AvrPphB Suppresses AvrB-Induced Activation of RPM1 but Not AvrRpm1-Induced Activation.2015 · DOI: 10.1094/mpmi-08-14-0248-r
`At5g35580`	Involved in defense responses.	PBL13 Is a Serine/Threonine Protein Kinase That Negatively Regulates Arabidopsis Immune Responses.2015 · DOI: 10.1104/pp.15.01391

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000612 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0012501 programmed cell death Biological Process

GO:0032491 detection of molecule of fungal origin Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050777 negative regulation of immune response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0062207 regulation of pattern recognition receptor signaling pathway Biological Process

GO:1901141 regulation of lignin biosynthetic process Biological Process

GO:1903428 positive regulation of reactive oxygen species biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G61590

ath:AT2G05940

ath:AT5G35580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.527

Rank 1 · TkA01G599520 · TK1151

Nucleus0.398

Rank 2 · TkA01G599520 · TK1151

Cell membrane0.148

Rank 3 · TkA01G599520 · TK1151

Mitochondrion0.087

Rank 4 · TkA01G599520 · TK1151

Endoplasmic reticulum0.058

Rank 5 · TkA01G599520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr45-83 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G599520	`PF07714`	PK_Tyr_Ser-Thr	45	83	0.0044	17.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SY91`	Arabidopsis thaliana	sp\|Q9SY91\|PBL15_ARATH Probable serine/threonine-protein kinase PBL15	71.100%	Swiss-Prot	High
`Q9ZUF4`	Arabidopsis thaliana	sp\|Q9ZUF4\|RIPK_ARATH Serine/threonine-protein kinase RIPK	61.500%	Swiss-Prot	High
`F4JZW1`	Arabidopsis thaliana	sp\|F4JZW1\|PBL13_ARATH Serine/threonine-protein kinase PBL13	58.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card