TkA01G594810 | RubberDandelionOmics

Gene overview

TkA01G594810

Reference: TK1151 Chr: Chr01 Coordinates: 149771999-149775284 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1959 bp · TkA01G594810|TK1151|cDNA

AAGAAACCCTAATAAAAATGTCTGGTTACGGTCACGAAGGAGATGGATCTGCTCCACCTCCCGTCGGTGGAGGCTACAGTGGAAGTAGCGGTGGTGGTGGAGGCGGATATGGCAGTAGCGGTGGCGGAGGCGGTTATGGAGGAAGTGGTGGTGGAGGCAGTTACGGAAGCAGTGGTGGTGGAGGAGGAGGATCCTATGGCGGAAGCCGTGGTGGAGGTGGTGGATATGGAGGCGGGGGCCGTGGTGGAAGTGGAGGCGGA...

CDS

Download CDS FASTA

1500 bp · TkA01G594810|TK1151|CDS

ATGTCTGGTTACGGTCACGAAGGAGATGGATCTGCTCCACCTCCCGTCGGTGGAGGCTACAGTGGAAGTAGCGGTGGCTATGGAGGTGGCGGTGGTGGTGGAGGTTACGGAGGTAGCGGTGGTGGTGGAGGCGGATATGGCAGTAGCGGTGGCGGAGGCGGTTATGGAGGAAGTGGTGGTGGAGGCAGTTACGGAAGCAGTGGTGGTGGAGGAGGAGGATCCTATGGCGGAAGCCGTGGTGGAGGTGGTGGATATGGAGG...

Protein

Download Protein FASTA

499 aa · TkA01G594810|TK1151|PROTEIN

MSGYGHEGDGSAPPPVGGGYSGSSGGYGGGGGGGGYGGSGGGGGGYGSSGGGGGYGGSGGGGSYGSSGGGGGGSYGGSRGGGGGYGGGGRGGSGGGGGGYGSRGGSGGRESGGGGGYGGNSQSRGAGGGYQGGDRGRGGGGGGGRGGGRGSGRDGDWPCPNPGCGNSNFSWRTECNKCGTPSPAGAGAGGGTGGDRGRNDSGSYNKGGGGRSDSRGGSGGGYGGDRGGRGDYDGGSRGGGGSYGGSQGRDSGGGYGQGAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G594810`
TK1151 ID	TkA01G594810
OH-1004 ID	LXL04_000669
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 99.198 / OH-1004 90.164 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G594810

Location Chr01:149771999-149775284 (-)

Description Similar to TAF15B: Transcription initiation factor TFIID subunit 15b

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58470`	TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000669 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015030 Cajal body Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003712 transcription coregulator activity Molecular Function

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G58470

hsa:2130

mmu:14030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.925

Rank 1 · TkA01G594810 · TK1151

Cytoplasm0.291

Rank 2 · TkA01G594810 · TK1151

Extracellular0.042

Rank 3 · TkA01G594810 · TK1151

Cell membrane0.027

Rank 4 · TkA01G594810 · TK1151

Endoplasmic reticulum0.021

Rank 5 · TkA01G594810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00641Zn_ribbon_RanBP153-183 aa

PF00076RRM_1361-391 aa

PF00076RRM_1401-443 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G594810	`PF00641`	Zn_ribbon_RanBP	153	183	5e-07	29.6
TkA01G594810	`PF00076`	RRM_1	361	391	2.5e-10	40.8
TkA01G594810	`PF00076`	RRM_1	401	443	2.5e-10	40.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94KD0`	Arabidopsis thaliana	sp\|Q94KD0\|TA15B_ARATH Transcription initiation factor TFIID subunit 15b	49.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card