TkA01G594790 | RubberDandelionOmics

Gene overview

TkA01G594790

Reference: TK1151 Chr: Chr01 Coordinates: 149766874-149768967 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2019 bp · TkA01G594790|TK1151|cDNA

CTATTCACTACTGGCCACACATCTCCCTCGACCTTGCTACTGTGTTTGGCCCTAAATCCTCTCCATCCTCCAATTTCACTTCAAGCCTGTTAATGGCGGATCCGGCGGTCTCACTCAGCTGCCATGTGGTGGCGATACCATACCCCGGCAGAGGCCACGTCAACCCAATGATGAATCTCTGCAAACTCATTGCTCTCCGTCGTCCTTCCGACTTCCTCATCACTTTCATCCTGACCGAAGAATGGCTGAGCTTCATCGGC...

CDS

Download CDS FASTA

1455 bp · TkA01G594790|TK1151|CDS

ATGGCGGATCCGGCGGTCTCACTCAGCTGCCATGTGGTGGCGATACCATACCCCGGCAGAGGCCACGTCAACCCAATGATGAATCTCTGCAAACTCATTGCTCTCCGTCGTCCTTCCGACTTCCTCATCACTTTCATCCTGACCGAAGAATGGCTGAGCTTCATCGGCTCCGAGCCCAAACCAACTAACATTCGCTTCGCTACCATCCCTAACGTCATCCCATCGGAGGTCAACCGAGCCGCTGACTGGCATGGCTTCAT...

Protein

Download Protein FASTA

484 aa · TkA01G594790|TK1151|PROTEIN

MADPAVSLSCHVVAIPYPGRGHVNPMMNLCKLIALRRPSDFLITFILTEEWLSFIGSEPKPTNIRFATIPNVIPSEVNRAADWHGFINATQTNLEDPIEQLLRRMEVPASVLIYDTYLTWGVNLGNRMNIPVASLFTMSATVFSMTYHHDLLVKNGHVGDNFSEKAEEVIDYIPGVPPTRVADLVTAFNGNGKEVMPVSLQAVSMAAKAQFLLFVSVYELESQVIDAIKSELSIPVYAIGPAIPYFNLNNIENHQNTPDY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G594790`
TK1151 ID	TkA01G594790
OH-1004 ID	LXL04_000671
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 95.868 / OH-1004 94.309 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G594790

Location Chr01:149766874-149768967 (-)

Description Similar to UGT87A2: UDP-glycosyltransferase 87A2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30140`	UDP-glycosyltransferase 87A2.	No verified direct reference in this release
`At2g30150`	UDP-glycosyltransferase 87A1.	No verified direct reference in this release
`At2g28080`	UDP-glycosyltransferase 86A2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000671 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009909 regulation of flower development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G28080

ath:AT2G30140

ath:AT2G30150

ath:AT2G36970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.620

Rank 1 · TkA01G594790 · TK1151

Nucleus0.166

Rank 2 · TkA01G594790 · TK1151

Peroxisome0.145

Rank 3 · TkA01G594790 · TK1151

Endoplasmic reticulum0.086

Rank 4 · TkA01G594790 · TK1151

Plastid0.078

Rank 5 · TkA01G594790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26168Glyco_transf_N11-36 aa

PF26168Glyco_transf_N88-151 aa

PF09018Phage_Capsid_P3_N109-150 aa

PF10045DUF2280204-236 aa

PF00201UDPGT267-383 aa

PF10045DUF2280384-443 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G594790	`PF26168`	Glyco_transf_N	11	36	4.4e-06	27.5
TkA01G594790	`PF26168`	Glyco_transf_N	88	151	4.4e-06	27.5
TkA01G594790	`PF09018`	Phage_Capsid_P3_N	109	150	0.16	12.0
TkA01G594790	`PF10045`	DUF2280	204	236	0.035	15.0
TkA01G594790	`PF00201`	UDPGT	267	383	4e-18	66.2
TkA01G594790	`PF10045`	DUF2280	384	443	0.035	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64733`	Arabidopsis thaliana	sp\|O64733\|U87A2_ARATH UDP-glycosyltransferase 87A2	53.000%	Swiss-Prot	High
`O64732`	Arabidopsis thaliana	sp\|O64732\|U87A1_ARATH UDP-glycosyltransferase 87A1	50.900%	Swiss-Prot	High
`Q9ZUV0`	Arabidopsis thaliana	sp\|Q9ZUV0\|U86A2_ARATH UDP-glycosyltransferase 86A2	30.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card