TkA01G593710 | RubberDandelionOmics

Gene overview

TkA01G593710

Reference: TK1151 Chr: Chr01 Coordinates: 149495841-149497347 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

954 bp · TkA01G593710|TK1151|cDNA

CTTTATCCCGCTATATCGAAAAAAAAAACAAGAAAAACGGGAAAAACGGAATTAACGCATGTATCAAGATGCACAACGTAAACGAAATTTCTGGAATGTCGTGGATTTCGGAATAGAATCTGTAACAACATAGAAATCCTTTGTCCCTGATGATACAATTAAAAAAATCTCTCAATCGGAAAGCCGTAATCGCTGGATTTGAAGGAGGTCGGCAAATTGAATCATGGCTCTAAACCCACATCTCTACGGCAACGGAATGC...

CDS

Download CDS FASTA

594 bp · TkA01G593710|TK1151|CDS

ATGGCTCTAAACCCACATCTCTACGGCAACGGAATGCCGGTAGCATTCGTCAACGAGATCTTCGTCTTAAACAGAGACGGAATTGAATTTGAGATCAACAACATCCAAGGGGTTCGTGGAGGAACCGTTAGAACAAAAGGAAGAATCTTTTTGTCAAATGTGAGAATGGTTTTTGTTGCAGATAAACCACCTACAGATTTCTTCATTTCCTTTGACCTTCCCCTGCTTTATGTCCATGACGAAAAATTTAACCAACCGGT...

Protein

Download Protein FASTA

197 aa · TkA01G593710|TK1151|PROTEIN

MALNPHLYGNGMPVAFVNEIFVLNRDGIEFEINNIQGVRGGTVRTKGRIFLSNVRMVFVADKPPTDFFISFDLPLLYVHDEKFNQPVFHCNNISGLVEPVLPNDQNREMYPTHSFKILFKRGGCGTFVPLFLNLIKSVRQYNQMFQTANGPHVDPLRAAQTPVDEMMNAAYVDPSDPTKIFLQQPTSEAHKRDTYHS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G593710`
TK1151 ID	TkA01G593710
OH-1004 ID	LXL04_000688
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G593710`
Location	Chr01:149495841-149497347 (+)
Description	Similar to SPAC29B12.11c: UPF0664 stress-induced protein C29B12.11c (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000688` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0003713 transcription coactivator activity Molecular Function GO:0031490 chromatin DNA binding Molecular Function
KEGG gene cross-reference	spo:2542813 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.647

Rank 1 · TkA01G593710 · TK1151

Nucleus0.236

Rank 2 · TkA01G593710 · TK1151

Cell membrane0.216

Rank 3 · TkA01G593710 · TK1151

Lysosome / Vacuole0.156

Rank 4 · TkA01G593710 · TK1151

Golgi apparatus0.115

Rank 5 · TkA01G593710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11605Vps36_ESCRT-II11-79 aa

PF02893GRAM43-98 aa

PF24291Ig_CFAP6575-99 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G593710	`PF11605`	Vps36_ESCRT-II	11	79	0.096	13.6
TkA01G593710	`PF02893`	GRAM	43	98	0.21	12.1
TkA01G593710	`PF24291`	Ig_CFAP65	75	99	0.13	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card