TkA01G593140 | RubberDandelionOmics

Gene overview

TkA01G593140

Reference: TK1151 Chr: Chr01 Coordinates: 149314662-149316792 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1674 bp · TkA01G593140|TK1151|cDNA

CTGGGATGATCACCATCACAACTGCATGTGTTGAAGCCATTTGCACTGTCTCTCAGTCTCTGTAGATAGAAATCACGCAATTTAAACATACACTTTTTTGCATCGATCAATCTTTCGTCTCCATTGATGCACGGCTGGAGCTCCTTGAATGAAACAGAAAGAAGATCGGGGTAACTTGTTATGTTACATTCATGATACATCAATATATCGTATACAAGAAAAATGGACATTCAAGAGAATATATTGATGGGAAGATATGA...

CDS

Download CDS FASTA

1005 bp · TkA01G593140|TK1151|CDS

ATGGACATTCAAGAGAATATATTGATGGGAAGATATGAATTAGGTAGACTACTAGGTCAAGGCACATTTGCAAAGGTATACTATGCTCGCAATTTAACAACAGGATTAAGTGTAGCAATTAAGGTAATAGACAAAGACAAAGTTTCAAGAATCGGACTAATTAATCAAATCAAAAGAGAAATCTCAATTATGAGACTTGTAAAACACCCTAACATCTTACACCTCTACGAAGTCATGGCAACAAAATCCAAGATCTATTT...

Protein

Download Protein FASTA

334 aa · TkA01G593140|TK1151|PROTEIN

MDIQENILMGRYELGRLLGQGTFAKVYYARNLTTGLSVAIKVIDKDKVSRIGLINQIKREISIMRLVKHPNILHLYEVMATKSKIYFALEYAKGGELFNKVAKGRLKEHIARKYFQQLIHAVDFCHSRGVYHRDLKPENLLLDDNENLKVSDFGLSALAESKRDDGLLHTTCGTPAYVAPEVINRRGYDGDKADVWSCGVILYVLLAGYLPFHDSNILEMYRKIGKSEFRFPNWFPNDARRLVSRILDPNPVNRITISKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G593140`
TK1151 ID	TkA01G593140
OH-1004 ID	LXL04_036633
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	69.100
Protein coverage (%)	TK1151 95.210 / OH-1004 66.987 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G593140

Location Chr01:149314662-149316792 (-)

Description Similar to CIPK10: CBL-interacting serine/threonine-protein kinase 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45820`	CIPK serine-threonine protein kinases interact with CBL proteins.	Constitutive activation and transgenic evaluation of the function of an arabidopsis PKS protein kinase.2002 · DOI: 10.1074/jbc.m205504200

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0206700`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os05g0332300`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os07g0678600`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os03g0339900`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036633 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G07070

ath:AT5G58380

dosa:Os01g0206700

dosa:Os05g0332300

dosa:Os07g0678600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.541

Rank 1 · TkA01G593140 · TK1151

Nucleus0.414

Rank 2 · TkA01G593140 · TK1151

Cell membrane0.143

Rank 3 · TkA01G593140 · TK1151

Lysosome / Vacuole0.053

Rank 4 · TkA01G593140 · TK1151

Endoplasmic reticulum0.050

Rank 5 · TkA01G593140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase12-266 aa

PF07714PK_Tyr_Ser-Thr13-262 aa

PF14531Kinase-like15-61 aa

PF03109ABC122-66 aa

PF10140YukC59-156 aa

PF03109ABC186-165 aa

PF14531Kinase-like104-253 aa

PF06293Kdo106-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G593140	`PF00069`	Pkinase	12	266	1e-74	252.0
TkA01G593140	`PF07714`	PK_Tyr_Ser-Thr	13	262	1.4e-37	130.2
TkA01G593140	`PF14531`	Kinase-like	15	61	3e-07	30.7
TkA01G593140	`PF03109`	ABC1	22	66	6.5e-06	26.2
TkA01G593140	`PF10140`	YukC	59	156	0.1	12.2
TkA01G593140	`PF03109`	ABC1	86	165	6.5e-06	26.2
TkA01G593140	`PF14531`	Kinase-like	104	253	3e-07	30.7
TkA01G593140	`PF06293`	Kdo	106	149	0.046	13.9
TkA01G593140	`PF01636`	APH	125	148	0.21	12.0
TkA01G593140	`PF03822`	NAF	290	314	1.1e-09	38.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ54`	Arabidopsis thaliana	sp\|Q9FJ54\|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20	68.700%	Swiss-Prot	High
`Q9LWM4`	Oryza sativa subsp. japonica	sp\|Q9LWM4\|CIPK5_ORYSJ CBL-interacting protein kinase 5	65.400%	Swiss-Prot	High
`Q5W736`	Oryza sativa subsp. japonica	sp\|Q5W736\|CIPKI_ORYSJ CBL-interacting protein kinase 18	66.900%	Swiss-Prot	High
`Q7X996`	Oryza sativa subsp. japonica	sp\|Q7X996\|CIPK2_ORYSJ CBL-interacting protein kinase 2	67.100%	Swiss-Prot	High
`Q10LQ2`	Oryza sativa subsp. japonica	sp\|Q10LQ2\|CIPKA_ORYSJ CBL-interacting protein kinase 10	64.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card