TkA01G593060 | RubberDandelionOmics

Gene overview

TkA01G593060

Reference: TK1151 Chr: Chr01 Coordinates: 149289519-149290805 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1245 bp · TkA01G593060|TK1151|cDNA

ATGGCCTCCTCGGCGGCCAATTCGTTATTCGGCAAGTATGACGTCGGAAAACTCCTCGGCTGCGGCGCTTTCGCTAAGGTGTACCATGCTAGGGATATCAAAAACGGTCACAGCGTTGCCATTAAGGTAATCAATAAGCATAAAATCTCTCATAACGCTCATCTCGTCTCGAACGTGAAGCGCGAGATCGAGATTATGCGCCGGCTCCGGCATCCGAACATTGTTAAATTGTATGAAGTTATGGCAACGAAGACCAAGAT...

CDS

Download CDS FASTA

1245 bp · TkA01G593060|TK1151|CDS

ATGGCCTCCTCGGCGGCCAATTCGTTATTCGGCAAGTATGACGTCGGAAAACTCCTCGGCTGCGGCGCTTTCGCTAAGGTGTACCATGCTAGGGATATCAAAAACGGTCACAGCGTTGCCATTAAGGTAATCAATAAGCATAAAATCTCTCATAACGCTCATCTCGTCTCGAACGTGAAGCGCGAGATCGAGATTATGCGCCGGCTCCGGCATCCGAACATTGTTAAATTGTATGAAGTTATGGCAACGAAGACCAAGAT...

Protein

Download Protein FASTA

414 aa · TkA01G593060|TK1151|PROTEIN

MASSAANSLFGKYDVGKLLGCGAFAKVYHARDIKNGHSVAIKVINKHKISHNAHLVSNVKREIEIMRRLRHPNIVKLYEVMATKTKIYFVMEFVKGGELFAKVAKGRLSESQSRKYFQQLISAIGYCHSRDENGDLKVTDFGLSAVTGQIRADGLLHTLCGTPSYVAPEILTKRGYDGAKADIWSCGIILFVLNAAFLPFNDANLMIMYKKIYKGEYKCPKWMSSDLRRFLARILDTKPETRITVDEIKIDPWFRKGYKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G593060`
TK1151 ID	TkA01G593060
OH-1004 ID	LXL04_000699
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G593060

Location Chr01:149289519-149290805 (+)

Description Similar to CIPK11: CBL-interacting serine/threonine-protein kinase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30360`	CIPK serine-threonine protein kinases interact with CBL proteins.	Arabidopsis protein kinase PKS5 inhibits the plasma membrane H+ -ATPase by preventing interaction with 14-3-3 protein.2007 · DOI: 10.1105/tpc.105.035626
`At5g01820`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`At1g29230`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`At4g18700`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`At5g45810`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000699 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009268 response to pH Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009749 response to glucose Biological Process

GO:0019722 calcium-mediated signaling Biological Process

KEGG gene cross-reference

ath:AT1G29230

ath:AT2G30360

ath:AT4G18700

ath:AT5G01820

dosa:Os05g0514200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.530

Rank 1 · TkA01G593060 · TK1151

Nucleus0.432

Rank 2 · TkA01G593060 · TK1151

Cell membrane0.165

Rank 3 · TkA01G593060 · TK1151

Endoplasmic reticulum0.049

Rank 4 · TkA01G593060 · TK1151

Golgi apparatus0.047

Rank 5 · TkA01G593060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase13-254 aa

PF07714PK_Tyr_Ser-Thr15-249 aa

PF03109ABC119-47 aa

PF01163RIO145-122 aa

PF01636APH48-131 aa

PF03109ABC157-100 aa

PF06289FlbD236-244 aa

PF03822NAF281-339 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G593060	`PF00069`	Pkinase	13	254	1.9e-57	195.4
TkA01G593060	`PF07714`	PK_Tyr_Ser-Thr	15	249	1.1e-27	97.7
TkA01G593060	`PF03109`	ABC1	19	47	0.055	13.3
TkA01G593060	`PF01163`	RIO1	45	122	0.075	13.4
TkA01G593060	`PF01636`	APH	48	131	0.21	12.0
TkA01G593060	`PF03109`	ABC1	57	100	0.055	13.3
TkA01G593060	`PF06289`	FlbD	236	244	1.0	9.7
TkA01G593060	`PF03822`	NAF	281	339	6.7e-19	68.5
TkA01G593060	`PF06289`	FlbD	309	329	1.0	9.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22932`	Arabidopsis thaliana	sp\|O22932\|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11	60.300%	Swiss-Prot	High
`Q9LZW4`	Arabidopsis thaliana	sp\|Q9LZW4\|CIPKE_ARATH CBL-interacting serine/threonine-protein kinase 14	54.300%	Swiss-Prot	High
`Q9LP51`	Arabidopsis thaliana	sp\|Q9LP51\|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18	51.300%	Swiss-Prot	High
`Q9SN43`	Arabidopsis thaliana	sp\|Q9SN43\|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12	49.700%	Swiss-Prot	Medium
`Q9FJ55`	Arabidopsis thaliana	sp\|Q9FJ55\|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19	48.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card