TkA01G590210 | RubberDandelionOmics

Gene overview

TkA01G590210

Reference: TK1151 Chr: Chr01 Coordinates: 148506624-148508863 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1205 bp · TkA01G590210|TK1151|cDNA

AAAGCAGCAGGGGTGTTCCTACGTCAATCACCAATTAGAATCTGAAAACAGAAATCATCTTCAACCTAATTTCCCTCCAATTGCTCTCAGTGTATGTACTCTCTACCACTCTATTTCTCTAATTAGTTGGTAGATATGTATACTTTGTATAACTACGCCAATCTATCCATCCTCTTTACACTTTGACAGAAGCCATTCAGTAATCATGGATCTTAATGGTTGAAGAATCACAACGGGAAGTAAGTAAACATGAGCAGTCT...

CDS

Download CDS FASTA

711 bp · TkA01G590210|TK1151|CDS

ATGAGCAGTCTCTCAAATGCTTTTTCTTTGCTAGAACTGGATGTTGAAGATGATAGGGAAGAGACAACCAATGCTGCTGATAACAAAGAGAAATCCAACGGGAACCATGAGAAAGAAACTGATAGTAAAGTCACTCCTCAAACCTATGAAGGAGACTACAAGTTGCCTCTTGTGTGGATTGACTTGGAAATGACTGGATTGAATATTGAAGTAGATAGAATACTGGAGATTGCTTGTGTGATCACAGATGGGAAGTTGAC...

Protein

Download Protein FASTA

236 aa · TkA01G590210|TK1151|PROTEIN

MSSLSNAFSLLELDVEDDREETTNAADNKEKSNGNHEKETDSKVTPQTYEGDYKLPLVWIDLEMTGLNIEVDRILEIACVITDGKLTKSVEGPDLVINQTKECLEKMGEWCQDHHAASGLTERVIQSTTSEKEAEQQVIDFVKRHVGTYTPLLAGNSIYVDFLFLKKYMPDLASLFSHVVVDVSSVKALCLRWFPRDNKKAPRKENKHRAMDDIKESIAELKYYKDNVFKSQKPRK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G590210`
TK1151 ID	TkA01G590210
OH-1004 ID	LXL04_000750
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G590210

Location Chr01:148506624-148508863 (-)

Description Similar to At2g26970: Oligoribonuclease

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26970`	3'-to-5' exoribonuclease specific for small oligoribonucleotides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000750 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006139 nucleobase-containing compound metabolic process Biological Process

GO:0009117 nucleotide metabolic process Biological Process

GO:2000827 mitochondrial RNA surveillance Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005758 mitochondrial intermembrane space Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005925 focal adhesion Cellular Component

GO:0000175 3'-5'-RNA exonuclease activity Molecular Function

GO:0000287 magnesium ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G26970

bta:540139

hsa:25996

mmu:104444

rno:300689

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.573

Rank 1 · TkA01G590210 · TK1151

Nucleus0.468

Rank 2 · TkA01G590210 · TK1151

Mitochondrion0.114

Rank 3 · TkA01G590210 · TK1151

Cell membrane0.082

Rank 4 · TkA01G590210 · TK1151

Endoplasmic reticulum0.070

Rank 5 · TkA01G590210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00929RNase_T58-220 aa

PF16473Rv2179c-like59-216 aa

PF20930Dicer_PBD90-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G590210	`PF00929`	RNase_T	58	220	4.4e-34	119.1
TkA01G590210	`PF16473`	Rv2179c-like	59	216	0.0064	17.0
TkA01G590210	`PF20930`	Dicer_PBD	90	118	0.13	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVE0`	Arabidopsis thaliana	sp\|Q9ZVE0\|ORN_ARATH Oligoribonuclease	62.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card