TkA01G585640 | RubberDandelionOmics

Gene overview

TkA01G585640

Reference: TK1151 Chr: Chr01 Coordinates: 147293854-147294195 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

342 bp · TkA01G585640|TK1151|cDNA

ATGGCGTTGAAATACCACCCGGACGTATCGGCGCCGGATCGGGCGGAGGAGAATACGATGAGGTTTATTAAGGTCCAGGAAGCGTACGAGACGTTATCTGACCCGGATGCTCGAGCTAGGTATGATAGTAGCATGGAGAAGGCTTTTTCTGGGAAGAAAGGGTCTCGGTTTGAGGCGAGATGGGAGGAGAAATCACGGTGGAAACAGTCGTGGCAGGTGCAGGTGGCGGAGCTGAAACGGAGGAGGACGGTGGATACGGT...

CDS

Download CDS FASTA

342 bp · TkA01G585640|TK1151|CDS

ATGGCGTTGAAATACCACCCGGACGTATCGGCGCCGGATCGGGCGGAGGAGAATACGATGAGGTTTATTAAGGTCCAGGAAGCGTACGAGACGTTATCTGACCCGGATGCTCGAGCTAGGTATGATAGTAGCATGGAGAAGGCTTTTTCTGGGAAGAAAGGGTCTCGGTTTGAGGCGAGATGGGAGGAGAAATCACGGTGGAAACAGTCGTGGCAGGTGCAGGTGGCGGAGCTGAAACGGAGGAGGACGGTGGATACGGT...

Protein

Download Protein FASTA

113 aa · TkA01G585640|TK1151|PROTEIN

MALKYHPDVSAPDRAEENTMRFIKVQEAYETLSDPDARARYDSSMEKAFSGKKGSRFEARWEEKSRWKQSWQVQVAELKRRRTVDTVSVDEGGRKSWASRIREERRAHGSTIS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G585640`
TK1151 ID	TkA01G585640
OH-1004 ID	LXL04_000813
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 55.122 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G585640

Location Chr01:147293854-147294195 (+)

Description Similar to ATJ20: Chaperone protein dnaJ 20, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13830`	Plays a continuous role in plant development probably in the structural organization of compartments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000813 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002639 positive regulation of immunoglobulin production Biological Process

GO:0006260 DNA replication Biological Process

GO:0006457 protein folding Biological Process

GO:0006986 response to unfolded protein Biological Process

GO:0009408 response to heat Biological Process

GO:0010322 regulation of isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0042026 protein refolding Biological Process

GO:1903895 negative regulation of IRE1-mediated unfolded protein response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

KEGG gene cross-reference

ath:AT4G13830

hsa:4189

lfe:LAF_0752

mmu:27362

pon:100172910

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.452

Rank 1 · TkA01G585640 · TK1151

Cytoplasm0.233

Rank 2 · TkA01G585640 · TK1151

Peroxisome0.185

Rank 3 · TkA01G585640 · TK1151

Nucleus0.172

Rank 4 · TkA01G585640 · TK1151

Endoplasmic reticulum0.027

Rank 5 · TkA01G585640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226DnaJ1-42 aa

PF28019HmpF54-82 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G585640	`PF00226`	DnaJ	1	42	2.2e-11	44.4
TkA01G585640	`PF28019`	HmpF	54	82	0.21	10.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SDN0`	Arabidopsis thaliana	sp\|Q9SDN0\|DNJ20_ARATH Chaperone protein dnaJ 20, chloroplastic	47.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card