TkA01G557680 | RubberDandelionOmics

Gene overview

TkA01G557680

Reference: TK1151 Chr: Chr01 Coordinates: 140232682-140234515 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

854 bp · TkA01G557680|TK1151|cDNA

TTAAAACTTAAAAGTAAATTCCAACCACGTCCCAAAATGAAATAGATGAACATGAACGGAACACAAGTAGGCAATAATTGGAGGGTTGCAATTGAAAATTATCCAAAATACCGGCGACTGTGCGAGACCGCCGAACCAAAATTGCAATCTTACGAAGGAGAGAAAAAAAGAAGAAGAAGATGGACACAGAGTGGTACAACGACGTTCCCTGCTCTTCGATCGCCGTCGAGTCCATCATTAACGTGGGAACTGCCGGATTA...

CDS

Download CDS FASTA

393 bp · TkA01G557680|TK1151|CDS

ATGGACACAGAGTGGTACAACGACGTTCCCTGCTCTTCGATCGCCGTCGAGTCCATCATTAACGTGGGAACTGCCGGATTAATTTGGGGTTCATGTTCTGGTTCTTATGATGCGAAGAAAATAGGTCTGACCGGCATTGCTCGTGCTTCCTTCGTGGGCAAGACGGTTGGTAAATATGGGTTCCAATGTGGACTGTTTGCTGGAATATTTTCATTTACACGGTGTGGGATTCGAAGATACCGCAAGAAAAACGATTGGGT...

Protein

Download Protein FASTA

130 aa · TkA01G557680|TK1151|PROTEIN

MDTEWYNDVPCSSIAVESIINVGTAGLIWGSCSGSYDAKKIGLTGIARASFVGKTVGKYGFQCGLFAGIFSFTRCGIRRYRKKNDWVNALVAGGVAGAAIGAGTRNWKQVALMTAFLSGFCAIADQSRAI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G557680`
TK1151 ID	TkA01G557680
OH-1004 ID	LXL04_001150
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G557680

Location Chr01:140232682-140234515 (+)

Description Similar to OEP164: Outer envelope pore protein 16-4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62880`	Voltage-dependent high-conductance channel with a slight cation-selectivity; selective for amino acids but excludes triosephosphates or uncharged sugars (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001150 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006811 monoatomic ion transport Biological Process

GO:0009409 response to cold Biological Process

GO:0009611 response to wounding Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009749 response to glucose Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0045037 protein import into chloroplast stroma Biological Process

GO:0045039 protein insertion into mitochondrial inner membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G28900

ath:AT3G62880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.893

Rank 1 · TkA01G557680 · TK1151

Cytoplasm0.056

Rank 2 · TkA01G557680 · TK1151

Plastid0.046

Rank 3 · TkA01G557680 · TK1151

Nucleus0.038

Rank 4 · TkA01G557680 · TK1151

Cell membrane0.018

Rank 5 · TkA01G557680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02466Tim1718-119 aa

PF30969DUF876743-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G557680	`PF02466`	Tim17	18	119	9.4e-15	55.6
TkA01G557680	`PF30969`	DUF8767	43	123	0.053	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZH8`	Arabidopsis thaliana	sp\|Q9LZH8\|OP164_ARATH Outer envelope pore protein 16-4, chloroplastic	54.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card