TkA01G468510 | RubberDandelionOmics

Gene overview

TkA01G468510

Reference: TK1151 Chr: Chr01 Coordinates: 117322139-117322753 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

585 bp · TkA01G468510|TK1151|cDNA

ATGGCAACTACTTTCGACCGTCAACACCACACAACCCAACACCACACCACCCAACAACCCCACTTCCGCTATGATCGCTCCGGCGATAAACTCCCGTACCCTCAACCAGGCCCCTCCGGCAGCAAAATAATGGCCATCATGGCCTTGCTTCCCATCGGCGGAATCTTGCTTGGCCTTGCGGGAATAACCCTCGTCGGTACCATGATCGGACTTGCTATTGCTACTCCGGTGTTCATCATTTTCAGTCCGGTTATTGTCCC...

CDS

Download CDS FASTA

585 bp · TkA01G468510|TK1151|CDS

ATGGCAACTACTTTCGACCGTCAACACCACACAACCCAACACCACACCACCCAACAACCCCACTTCCGCTATGATCGCTCCGGCGATAAACTCCCGTACCCTCAACCAGGCCCCTCCGGCAGCAAAATAATGGCCATCATGGCCTTGCTTCCCATCGGCGGAATCTTGCTTGGCCTTGCGGGAATAACCCTCGTCGGTACCATGATCGGACTTGCTATTGCTACTCCGGTGTTCATCATTTTCAGTCCGGTTATTGTCCC...

Protein

Download Protein FASTA

194 aa · TkA01G468510|TK1151|PROTEIN

MATTFDRQHHTTQHHTTQQPHFRYDRSGDKLPYPQPGPSGSKIMAIMALLPIGGILLGLAGITLVGTMIGLAIATPVFIIFSPVIVPAILTIGLAVTGFLTSGTFGLTGLSSLSYLFSMLRQSTPSLHDQIDYAKETVQDVGMYAGQKTKEVGQTIQHKAHEMGTQGQAGTGGGATVHVQTGGGKEGGKGGDRT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G468510`
TK1151 ID	TkA01G468510
OH-1004 ID	LXL04_013270
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	68.200
Protein coverage (%)	TK1151 90.206 / OH-1004 94.624 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G468510`
Location	Chr01:117322139-117322753 (+)
Description	Similar to Oleosin (Fragment)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013270` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009791 post-embryonic development Biological Process GO:0010344 seed oilbody biogenesis Biological Process GO:0010431 seed maturation Biological Process GO:0019915 lipid storage Biological Process GO:0034389 lipid droplet organization Biological Process GO:0048608 reproductive structure development Biological Process GO:0050826 response to freezing Biological Process GO:0012511 monolayer-surrounded lipid storage body Cellular Component GO:0016020 membrane Cellular Component
KEGG gene cross-reference	ath:AT3G01570 ghi:107938770 sind:105177100 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.319

Rank 1 · TkA01G468510 · TK1151

Endoplasmic reticulum0.232

Rank 2 · TkA01G468510 · TK1151

Cell membrane0.206

Rank 3 · TkA01G468510 · TK1151

Nucleus0.177

Rank 4 · TkA01G468510 · TK1151

Mitochondrion0.157

Rank 5 · TkA01G468510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01277Oleosin42-153 aa

PF07332Phage_holin_3_652-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G468510	`PF01277`	Oleosin	42	153	2e-38	131.3
TkA01G468510	`PF07332`	Phage_holin_3_6	52	131	0.25	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card