TkA01G191830 | RubberDandelionOmics

Gene overview

TkA01G191830

Reference: TK1151 Chr: Chr01 Coordinates: 49146259-49147408 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

630 bp · TkA01G191830|TK1151|cDNA

ATGGGAGGATACCACTGGGACAAACCGATGGTGTCCGACATCGCTCCGGTACCACAGGACGATGGCCCTAACCCCGTTGTCCCCATTGCGTACTCGGAAGAGTTCGCTGAGACTATGGACTACTTTCGAGCTGTATATCTGGCCGATGAGCGATCACTTCGTGCTCTTCGACTAACCACCGAAGCAATCCACTTGAATGCCGGAAATTACACCGTATGGCAATTCAGAAGAGTAATACTCGAGTCTCTCAATGCTGATTT...

CDS

Download CDS FASTA

630 bp · TkA01G191830|TK1151|CDS

ATGGGAGGATACCACTGGGACAAACCGATGGTGTCCGACATCGCTCCGGTACCACAGGACGATGGCCCTAACCCCGTTGTCCCCATTGCGTACTCGGAAGAGTTCGCTGAGACTATGGACTACTTTCGAGCTGTATATCTGGCCGATGAGCGATCACTTCGTGCTCTTCGACTAACCACCGAAGCAATCCACTTGAATGCCGGAAATTACACCGTATGGCAATTCAGAAGAGTAATACTCGAGTCTCTCAATGCTGATTT...

Protein

Download Protein FASTA

209 aa · TkA01G191830|TK1151|PROTEIN

MGGYHWDKPMVSDIAPVPQDDGPNPVVPIAYSEEFAETMDYFRAVYLADERSLRALRLTTEAIHLNAGNYTVWQFRRVILESLNADLQGELEFVEHLASKNSKTTSYGHHRRWVAEKLGSESASRELEFTKNIFLNDAKNYHAWSHRQWVLQNLGGWEDELAYCDKLLEDDIFNNSAWNQVHIFHCMLSTEIVIILVFIYSELIRQIIM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G191830`
TK1151 ID	TkA01G191830
OH-1004 ID	LXL04_004171
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.600
Protein coverage (%)	TK1151 82.775 / OH-1004 51.183 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G191830

Location Chr01:49146259-49147408 (-)

Description Similar to FTA: Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59380`	Essential subunit of both the farnesyltransferase and the geranylgeranyltransferase complex.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004171 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007323 peptide pheromone maturation Biological Process

GO:0008360 regulation of cell shape Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0018342 protein prenylation Biological Process

GO:0018343 protein farnesylation Biological Process

GO:0018344 protein geranylgeranylation Biological Process

GO:0035022 positive regulation of Rac protein signal transduction Biological Process

GO:0048509 regulation of meristem development Biological Process

GO:0060632 regulation of microtubule-based movement Biological Process

GO:0071340 skeletal muscle acetylcholine-gated channel clustering Biological Process

GO:0080120 CAAX-box protein maturation Biological Process

KEGG gene cross-reference

ath:AT3G59380

bta:281169

hsa:2339

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.711

Rank 1 · TkA01G191830 · TK1151

Nucleus0.409

Rank 2 · TkA01G191830 · TK1151

Peroxisome0.082

Rank 3 · TkA01G191830 · TK1151

Mitochondrion0.063

Rank 4 · TkA01G191830 · TK1151

Endoplasmic reticulum0.044

Rank 5 · TkA01G191830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01239PPTA54-82 aa

PF13961DUF421965-74 aa

PF01239PPTA88-103 aa

PF01239PPTA109-117 aa

PF08102Antimicrobial_7111-119 aa

PF01239PPTA125-154 aa

PF08102Antimicrobial_7131-143 aa

PF13961DUF4219137-152 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G191830	`PF01239`	PPTA	54	82	1.9e-25	87.5
TkA01G191830	`PF13961`	DUF4219	65	74	1.5	9.4
TkA01G191830	`PF01239`	PPTA	88	103	1.9e-25	87.5
TkA01G191830	`PF01239`	PPTA	109	117	1.9e-25	87.5
TkA01G191830	`PF08102`	Antimicrobial_7	111	119	0.32	12.0
TkA01G191830	`PF01239`	PPTA	125	154	1.9e-25	87.5
TkA01G191830	`PF08102`	Antimicrobial_7	131	143	0.32	12.0
TkA01G191830	`PF13961`	DUF4219	137	152	1.5	9.4
TkA01G191830	`PF01239`	PPTA	157	180	1.9e-25	87.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX33`	Arabidopsis thaliana	sp\|Q9LX33\|FNTA_ARATH Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha	65.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card