TkA01G169190 | RubberDandelionOmics

Gene overview

TkA01G169190

Reference: TK1151 Chr: Chr01 Coordinates: 43383560-43384265 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

486 bp · TkA01G169190|TK1151|cDNA

CGGATCTTTAGGTTGCCAGTTACTCAACCGGTCAACAGTCAAATTAAGTCAAGCAGGCAGAAGGACGCTGCTGCCAAGCAGTTAATTGAGAATCATTACAAAAATTATCTACAAGGATTGCAAGATCGTAAAGAAAGGAAACGAGCTTTACAGAGAAAGGCTGCTGAAGCTCAAGTATCGACTGAAGAAGAGGAGCAGATGCTACGGAGTTTGGAGAAGAAAGAGACAGAGTACTTGAGATTGCAAAGGCATAAAATCGG...

CDS

Download CDS FASTA

486 bp · TkA01G169190|TK1151|CDS

CGGATCTTTAGGTTGCCAGTTACTCAACCGGTCAACAGTCAAATTAAGTCAAGCAGGCAGAAGGACGCTGCTGCCAAGCAGTTAATTGAGAATCATTACAAAAATTATCTACAAGGATTGCAAGATCGTAAAGAAAGGAAACGAGCTTTACAGAGAAAGGCTGCTGAAGCTCAAGTATCGACTGAAGAAGAGGAGCAGATGCTACGGAGTTTGGAGAAGAAAGAGACAGAGTACTTGAGATTGCAAAGGCATAAAATCGG...

Protein

Download Protein FASTA

161 aa · TkA01G169190|TK1151|PROTEIN

RIFRLPVTQPVNSQIKSSRQKDAAAKQLIENHYKNYLQGLQDRKERKRALQRKAAEAQVSTEEEEQMLRSLEKKETEYLRLQRHKIGIDDIELLTLIGKGAFGEVRLCRAKSNGEVFAMKKLKKSDMLSRGQVDHVRSERNLLVEVDSRCIVKTKAIATRM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G169190`
TK1151 ID	TkA01G169190
OH-1004 ID	LXL04_012369
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.100
Protein coverage (%)	TK1151 72.050 / OH-1004 95.726 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G169190`
Location	Chr01:43383560-43384265 (+)
Description	Similar to STK38L: Serine/threonine-protein kinase 38-like
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012369` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000077 DNA damage checkpoint signaling Biological Process GO:0006468 protein phosphorylation Biological Process GO:0006974 DNA damage response Biological Process GO:0007165 signal transduction Biological Process GO:0010507 negative regulation of autophagy Biological Process GO:0010508 positive regulation of autophagy Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0043407 negative regulation of MAP kinase activity Biological Process GO:0051012 microtubule sliding Biological Process GO:0051128 regulation of cellular component organization Biological Process GO:0099173 postsynapse organization Biological Process GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	dpo:4813412 hsa:23012 mmu:106504 mmu:232533 pon:100173048 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.608

Rank 1 · TkA01G169190 · TK1151

Nucleus0.357

Rank 2 · TkA01G169190 · TK1151

Cell membrane0.122

Rank 3 · TkA01G169190 · TK1151

Mitochondrion0.052

Rank 4 · TkA01G169190 · TK1151

Golgi apparatus0.047

Rank 5 · TkA01G169190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF31042DUF878221-76 aa

PF14703PHM7_cyt31-96 aa

PF00069Pkinase38-38 aa

PF07714PK_Tyr_Ser-Thr56-69 aa

PF20845Pcf11_helical62-87 aa

PF07714PK_Tyr_Ser-Thr92-159 aa

PF00069Pkinase93-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G169190	`PF31042`	DUF8782	21	76	0.19	12.5
TkA01G169190	`PF14703`	PHM7_cyt	31	96	0.1	13.6
TkA01G169190	`PF00069`	Pkinase	38	38	1.4e-09	38.5
TkA01G169190	`PF07714`	PK_Tyr_Ser-Thr	56	69	0.0026	17.8
TkA01G169190	`PF20845`	Pcf11_helical	62	87	0.011	16.2
TkA01G169190	`PF07714`	PK_Tyr_Ser-Thr	92	159	0.0026	17.8
TkA01G169190	`PF00069`	Pkinase	93	157	1.4e-09	38.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card