TkA01G116200 | RubberDandelionOmics

Gene overview

TkA01G116200

Reference: TK1151 Chr: Chr01 Coordinates: 29422859-29423815 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

900 bp · TkA01G116200|TK1151|cDNA

ATGCCTCTCGCAAAAACCTTTAAACACCTCATGATACCACTAGAAGCAATACAATTAGCAACAAACAACTTTGCTGATGAATATCTCATAGGGAGAGGAGGTTTTGGAGAGGTTTACAAGGGAGAGCTTCTTCTATCCAAGAAGCTAACTACAGTTGCTATGAAGCGGTTAGATCCTAAATTTGGACAAGGGAACCCTGAGTTTTGGAAGGAGATCATTACACTTTCTCGTTACAAACATGAGAATATTATTTCTCTATT...

CDS

Download CDS FASTA

900 bp · TkA01G116200|TK1151|CDS

ATGCCTCTCGCAAAAACCTTTAAACACCTCATGATACCACTAGAAGCAATACAATTAGCAACAAACAACTTTGCTGATGAATATCTCATAGGGAGAGGAGGTTTTGGAGAGGTTTACAAGGGAGAGCTTCTTCTATCCAAGAAGCTAACTACAGTTGCTATGAAGCGGTTAGATCCTAAATTTGGACAAGGGAACCCTGAGTTTTGGAAGGAGATCATTACACTTTCTCGTTACAAACATGAGAATATTATTTCTCTATT...

Protein

Download Protein FASTA

299 aa · TkA01G116200|TK1151|PROTEIN

MPLAKTFKHLMIPLEAIQLATNNFADEYLIGRGGFGEVYKGELLLSKKLTTVAMKRLDPKFGQGNPEFWKEIITLSRYKHENIISLLGFCDESGEKIIVYEYALKKSLDLHLGDDDLTWIERLKICIGMARGLAYLHDPNGTNQRVLHRDIKSANILLDDNWIAKISDLGLSKFSPANQQYTFLVSNTVGTIGYCDPVYVETGFLTKEADVYSFGVVLFEVLCGRLCISNKYQVHGSLIGLNGMSHESLNAFTTIAYRCL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G116200`
TK1151 ID	TkA01G116200
OH-1004 ID	LXL04_004745
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.700
Protein coverage (%)	TK1151 94.983 / OH-1004 82.405 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G116200

Location Chr01:29422859-29423815 (+)

Description Similar to HERK1: Receptor-like protein kinase HERK 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At1g30570`	Probable receptor-like protein kinase At1g30570.	No verified direct reference in this release
`At2g39360`	Probable receptor-like protein kinase At2g39360.	No verified direct reference in this release
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004745 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0043680 filiform apparatus Cellular Component

GO:0090404 pollen tube tip Cellular Component

GO:0099503 secretory vesicle Cellular Component

KEGG gene cross-reference

ath:AT1G30570

ath:AT2G39360

ath:AT3G04690

ath:AT3G46290

ath:AT5G59700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.512

Rank 1 · TkA01G116200 · TK1151

Cell membrane0.353

Rank 2 · TkA01G116200 · TK1151

Nucleus0.262

Rank 3 · TkA01G116200 · TK1151

Endoplasmic reticulum0.053

Rank 4 · TkA01G116200 · TK1151

Golgi apparatus0.050

Rank 5 · TkA01G116200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase27-274 aa

PF07714PK_Tyr_Ser-Thr30-276 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G116200	`PF00069`	Pkinase	27	274	2.6e-37	129.4
TkA01G116200	`PF07714`	PK_Tyr_Ser-Thr	30	276	2.1e-40	139.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX66`	Arabidopsis thaliana	sp\|Q9LX66\|HERK_ARATH Receptor-like protein kinase HERK 1	44.900%	Swiss-Prot	Medium
`Q9FN92`	Arabidopsis thaliana	sp\|Q9FN92\|Y5597_ARATH Probable receptor-like protein kinase At5g59700	45.000%	Swiss-Prot	Medium
`Q9SA72`	Arabidopsis thaliana	sp\|Q9SA72\|Y1357_ARATH Probable receptor-like protein kinase At1g30570	43.200%	Swiss-Prot	Medium
`O80623`	Arabidopsis thaliana	sp\|O80623\|Y2393_ARATH Probable receptor-like protein kinase At2g39360	41.200%	Swiss-Prot	Medium
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	41.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card