TkA01G101700 | RubberDandelionOmics

Gene overview

TkA01G101700

Reference: TK1151 Chr: Chr01 Coordinates: 25742961-25743740 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

691 bp · TkA01G101700|TK1151|cDNA

CGGCGGAAACGTCGACGTTGTGTCAGTTGAAGATGGGATCGTTTCTCTCAAGCTACAAGGTTAGTATTAGGTCTTCATGTCTTCTTCATTTTCAAACCGTTATGGTGTTAACCAAAACACGATCTGAATCAGGCGCCTGCGGGACTTGTCCAAGCTCAACAACGACCATGAAAATGGGGATCGAAAGAGTACTCAAAGAGAATTCGGAGATGCAGTTAAGGATATCGTTCAAAGTGTTTGATGAACAACCTGCAGAAACA...

CDS

Download CDS FASTA

426 bp · TkA01G101700|TK1151|CDS

ATGGGATCGTTTCTCTCAAGCTACAAGGTTAGTATTAGGTCTTCATGTCTTCTTCATTTTCAAACCGTTATGGTGTTAACCAAAACACGATCTGAATCAGGCGCCTGCGGGACTTGTCCAAGCTCAACAACGACCATGAAAATGGGGATCGAAAGAGTACTCAAAGAGAATTCGGAGATGCAGTTAAGGATATCGTTCAAAGTGTTTGATGAACAACCTGCAGAAACAAACGTCGAGGCGGTGAATAGGCATCTCGATAT...

Protein

Download Protein FASTA

141 aa · TkA01G101700|TK1151|PROTEIN

MGSFLSSYKVSIRSSCLLHFQTVMVLTKTRSESGACGTCPSSTTTMKMGIERVLKENSEMQLRISFKVFDEQPAETNVEAVNRHLDILRPAIANFGGSVEVLSVEGGECCVKYTGPESIGSGIKAAIKEKFPDVQNVVLTE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G101700`
TK1151 ID	TkA01G101700
OH-1004 ID	LXL04_004847
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.800
Protein coverage (%)	TK1151 76.596 / OH-1004 48.869 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G101700

Location Chr01:25742961-25743740 (+)

Description Similar to NIFU1: NifU-like protein 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g01940`	Molecular scaffold for [Fe-S] cluster assembly of chloroplastic iron-sulfur proteins.	No verified direct reference in this release
`At5g49940`	Molecular scaffold for [Fe-S] cluster assembly of chloroplastic iron-sulfur proteins.	No verified direct reference in this release
`At4g25910`	Molecular scaffold for [Fe-S] cluster assembly of chloroplastic iron-sulfur proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004847 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0048564 photosystem I assembly Biological Process

GO:0051604 protein maturation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005198 structural molecule activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0051536 iron-sulfur cluster binding Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT4G01940

ath:AT4G25910

ath:AT5G49940

bsu:BSU32220

dosa:Os12g0176200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.596

Rank 1 · TkA01G101700 · TK1151

Nucleus0.399

Rank 2 · TkA01G101700 · TK1151

Mitochondrion0.163

Rank 3 · TkA01G101700 · TK1151

Cell membrane0.073

Rank 4 · TkA01G101700 · TK1151

Endoplasmic reticulum0.062

Rank 5 · TkA01G101700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01106NifU33-59 aa

PF20490SCGB3A73-121 aa

PF01106NifU82-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G101700	`PF01106`	NifU	33	59	3.1e-16	60.0
TkA01G101700	`PF20490`	SCGB3A	73	121	0.0073	17.2
TkA01G101700	`PF01106`	NifU	82	138	3.1e-16	60.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93W77`	Arabidopsis thaliana	sp\|Q93W77\|NIFU1_ARATH NifU-like protein 1, chloroplastic	68.200%	Swiss-Prot	High
`Q93W20`	Arabidopsis thaliana	sp\|Q93W20\|NIFU2_ARATH NifU-like protein 2, chloroplastic	35.100%	Swiss-Prot	Medium
`Q84RQ7`	Arabidopsis thaliana	sp\|Q84RQ7\|NIFU3_ARATH NifU-like protein 3, chloroplastic	33.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card