TkA01G079290 | RubberDandelionOmics

Gene overview

TkA01G079290

Reference: TK1151 Chr: Chr01 Coordinates: 20281468-20282574 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1107 bp · TkA01G079290|TK1151|cDNA

ATGGAGCTAGAAGTTGCCGGTGCCACCGAATCTCTAGTCACAGATCCATCAAACGCGGCGGCGGTGCCCCAATCTCTGTTAGTAATAAGAAAATTAGCTTCCTGCAACACTGGTGCTAGGACAAAAGCTCTCCGAGAACTCACCAATTGGCTTCCGACACAGCTCGAAATCTCCGATGACGAAATGAAAAAGCTATGGAAAGGACTCTTCTATTGCATGTGGCATTCCGATAAGGCTCCCGTACAGTCAAATCTCATCGA...

CDS

Download CDS FASTA

1107 bp · TkA01G079290|TK1151|CDS

ATGGAGCTAGAAGTTGCCGGTGCCACCGAATCTCTAGTCACAGATCCATCAAACGCGGCGGCGGTGCCCCAATCTCTGTTAGTAATAAGAAAATTAGCTTCCTGCAACACTGGTGCTAGGACAAAAGCTCTCCGAGAACTCACCAATTGGCTTCCGACACAGCTCGAAATCTCCGATGACGAAATGAAAAAGCTATGGAAAGGACTCTTCTATTGCATGTGGCATTCCGATAAGGCTCCCGTACAGTCAAATCTCATCGA...

Protein

Download Protein FASTA

368 aa · TkA01G079290|TK1151|PROTEIN

MELEVAGATESLVTDPSNAAAVPQSLLVIRKLASCNTGARTKALRELTNWLPTQLEISDDEMKKLWKGLFYCMWHSDKAPVQSNLIDRLSSLLLTLDVPLSLHYLSAFLTTLRREWSGIDVLRLDKFYLLIRRFINRSFEFLKKNSWDLELTRRVMTIYQEKSLLANEKKFLGNGVNYHIASVFLDEIKGYLPLSIETFEILCKPLFNVLVSSQDKVLVSKIRNTVFEPLLCMGKSLLEKKKNQETDIDPEVINFGTIAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G079290`
TK1151 ID	TkA01G079290
OH-1004 ID	LXL04_005159
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 99.185 / OH-1004 66.364 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G079290`
Location	Chr01:20281468-20282574 (-)
Description	Similar to RRP1B: Ribosomal RNA processing protein 1 homolog B
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005159` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006364 rRNA processing Biological Process GO:0006397 mRNA processing Biological Process GO:0008380 RNA splicing Biological Process GO:0034260 negative regulation of GTPase activity Biological Process GO:0043484 regulation of RNA splicing Biological Process GO:0043923 host-mediated activation of viral transcription Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0098586 cellular response to virus Biological Process GO:1902626 assembly of large subunit precursor of preribosome Biological Process GO:0000791 euchromatin Cellular Component
KEGG gene cross-reference	dme:Dmel_CG12396 hsa:23076 hsa:8568 mmu:72462 spo:2541297 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.876

Rank 1 · TkA01G079290 · TK1151

Cytoplasm0.219

Rank 2 · TkA01G079290 · TK1151

Mitochondrion0.036

Rank 3 · TkA01G079290 · TK1151

Cell membrane0.023

Rank 4 · TkA01G079290 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkA01G079290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05997Nop5227-244 aa

PF05997Nop52343-356 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G079290	`PF05997`	Nop52	27	244	1.1e-65	222.6
TkA01G079290	`PF05997`	Nop52	343	356	1.1e-65	222.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card