TkA01G055610 | RubberDandelionOmics

Gene overview

TkA01G055610

Reference: TK1151 Chr: Chr01 Coordinates: 14394381-14399840 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

846 bp · TkA01G055610|TK1151|cDNA

ATGTCCGGAGACGGCAGCTCAAATACAGATCTATCACTTCAAATTGCAAACCTGATCAAGAATGGCCTCAATTCTCAGCCTCAAAATCCAAAGCTTTCTGATAACCTACAAATCAAACTCAAACTCAACAGTCAAAATTATGCATTATGGACCCGAATGATTCGGGTTGCCATAGGTGGTAAGTCCAAAAACCTGTTAAAACACTTAACCTCAAACCCTCCAGATCAAACAGATGAAACTTATGAGCAATGGGAACAAGA...

CDS

Download CDS FASTA

846 bp · TkA01G055610|TK1151|CDS

ATGTCCGGAGACGGCAGCTCAAATACAGATCTATCACTTCAAATTGCAAACCTGATCAAGAATGGCCTCAATTCTCAGCCTCAAAATCCAAAGCTTTCTGATAACCTACAAATCAAACTCAAACTCAACAGTCAAAATTATGCATTATGGACCCGAATGATTCGGGTTGCCATAGGTGGTAAGTCCAAAAACCTGTTAAAACACTTAACCTCAAACCCTCCAGATCAAACAGATGAAACTTATGAGCAATGGGAACAAGA...

Protein

Download Protein FASTA

281 aa · TkA01G055610|TK1151|PROTEIN

MSGDGSSNTDLSLQIANLIKNGLNSQPQNPKLSDNLQIKLKLNSQNYALWTRMIRVAIGGKSKNLLKHLTSNPPDQTDETYEQWEQDDLIVFSWLIQNIEPILASNLTEFPTAKTLWEALVVTYSSGKDKLQTFNLHVKANEIKQGDISLENLWINLQGIWGEIERIDPNPMKCPEDIQIYTKIRSEQKLFQFLNALNRKYDPIKREILRLDPLPSAEKAYSALRKEEAHQHILGTTSNTEQTGVAAGLVASEPECNKGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G055610`
TK1151 ID	TkA01G055610
OH-1004 ID	LXL04_031485
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.500
Protein coverage (%)	TK1151 100.000 / OH-1004 16.299 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G055610`
Location	Chr01:14394381-14399840 (+)
Description	Similar to RE1: Retrovirus-related Pol polyprotein from transposon RE1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031485` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0003676 nucleic acid binding Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.684

Rank 1 · TkA01G055610 · TK1151

Nucleus0.346

Rank 2 · TkA01G055610 · TK1151

Mitochondrion0.058

Rank 3 · TkA01G055610 · TK1151

Plastid0.042

Rank 4 · TkA01G055610 · TK1151

Peroxisome0.037

Rank 5 · TkA01G055610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14244Retrotran_gag_338-63 aa

PF14223Retrotran_gag_262-127 aa

PF14223Retrotran_gag_2183-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G055610	`PF14244`	Retrotran_gag_3	38	63	0.0012	19.3
TkA01G055610	`PF14223`	Retrotran_gag_2	62	127	6.2e-07	30.0
TkA01G055610	`PF14223`	Retrotran_gag_2	183	231	6.2e-07	30.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card