Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1344 bp · TkA01G031710|TK1151|cDNA
ATGGCAGAACCCAAGAGGTATGTCACGTCCGAAGAGCTCAAAACTCACAACAAACCAGGGGATCTGTGGATCTGTATACAGGGGAAAGTGTACGACGTCTCACAGTGGATGCAAACCCACCCCGGCGGTGAACTGCCATTGTTGAACCTTGCTGGTCAAGACGTCACCGATGCGTACATCGCTCTTCATCCCTCCACCGCCTGGAAATATCTCGACAAGTTCTTCAATGGGTATTACCTCAAAGACTACGCCGTCTCCGA...
1344 bp · TkA01G031710|TK1151|CDS
ATGGCAGAACCCAAGAGGTATGTCACGTCCGAAGAGCTCAAAACTCACAACAAACCAGGGGATCTGTGGATCTGTATACAGGGGAAAGTGTACGACGTCTCACAGTGGATGCAAACCCACCCCGGCGGTGAACTGCCATTGTTGAACCTTGCTGGTCAAGACGTCACCGATGCGTACATCGCTCTTCATCCCTCCACCGCCTGGAAATATCTCGACAAGTTCTTCAATGGGTATTACCTCAAAGACTACGCCGTCTCCGA...
Protein
Download Protein FASTA447 aa · TkA01G031710|TK1151|PROTEIN
MAEPKRYVTSEELKTHNKPGDLWICIQGKVYDVSQWMQTHPGGELPLLNLAGQDVTDAYIALHPSTAWKYLDKFFNGYYLKDYAVSDVSKDYRKLYSDFSKMGLFEKKGHGVLISMVAIAMMFSVSVYGVLYSESAFVHLFSGGLMGFLWIQSGWLGHDSGHYQIMSNRKSNRFAQILTGNCLAGISIAWWKRNHTAHHIAVNSLEYDPDLQHMPVFAVSSKFFDSITSKYYGRKLNFDSITRFLVSYQHFTYYPVMIVA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G031710 |
|---|---|
| TK1151 ID | TkA01G031710 |
| OH-1004 ID | LXL04_005594 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G031710 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:8192918-8194261 (-) | |||||||||
| Description | Similar to Acyl-lipid (9-3)-desaturase | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006629 lipid metabolic process Biological Process GO:0006636 unsaturated fatty acid biosynthetic process Biological Process GO:0006665 sphingolipid metabolic process Biological Process GO:0030148 sphingolipid biosynthetic process Biological Process GO:0070417 cellular response to cold Biological Process GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0016717 oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water Molecular Function GO:0046872 metal ion binding Molecular Function GO:0052631 sphingolipid 8-(E/Z)-desaturase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ag:AAC49700 ath:AT2G46210 ath:AT3G61580 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00173Cyt-b59-79 aaPF14901Jiv9022-38 aaPF30501DUF8619110-151 aaPF00487FA_desaturase144-406 aaPF30501DUF8619287-328 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G031710 | PF00173 | Cyt-b5 | 9 | 79 | 3.8e-24 | 85.2 |
| TkA01G031710 | PF14901 | Jiv90 | 22 | 38 | 0.26 | 12.3 |
| TkA01G031710 | PF30501 | DUF8619 | 110 | 151 | 1.4 | 9.1 |
| TkA01G031710 | PF00487 | FA_desaturase | 144 | 406 | 2.7e-33 | 116.5 |
| TkA01G031710 | PF30501 | DUF8619 | 287 | 328 | 1.4 | 9.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.