TkA01G030260 | RubberDandelionOmics

Gene overview

TkA01G030260

Reference: TK1151 Chr: Chr01 Coordinates: 7775708-7776274 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

567 bp · TkA01G030260|TK1151|cDNA

ATGAATAGCGGTGGTGGTGGTGGTACTTCTTCCGTTTACAGAGGTGTACGGAAGAGGAAATGGGGGAAATGGGTGTCTGAAATACGTGAGCCTGGAAAGAATTCAAGAATCTGGTTAGGGAGTTTTGAGACACCTGAAATGGCGGCGGCTGCCTATGACGCGGCGGCGTTTTACCTCAGGGGTGATGTTTCACGGCTCAATTTCCCGGAACGGGTGAATTCTCTTCCTACGCCGGTTACCTCCAGTGCTGAATGCATTCG...

CDS

Download CDS FASTA

567 bp · TkA01G030260|TK1151|CDS

ATGAATAGCGGTGGTGGTGGTGGTACTTCTTCCGTTTACAGAGGTGTACGGAAGAGGAAATGGGGGAAATGGGTGTCTGAAATACGTGAGCCTGGAAAGAATTCAAGAATCTGGTTAGGGAGTTTTGAGACACCTGAAATGGCGGCGGCTGCCTATGACGCGGCGGCGTTTTACCTCAGGGGTGATGTTTCACGGCTCAATTTCCCGGAACGGGTGAATTCTCTTCCTACGCCGGTTACCTCCAGTGCTGAATGCATTCG...

Protein

Download Protein FASTA

188 aa · TkA01G030260|TK1151|PROTEIN

MNSGGGGGTSSVYRGVRKRKWGKWVSEIREPGKNSRIWLGSFETPEMAAAAYDAAAFYLRGDVSRLNFPERVNSLPTPVTSSAECIRMAAQEAAASLLGTSMGEQCGGGGGGGDGCSSGHTVPVNVGLSASQIQAINDSPLDSPKLWMDLSDHALMVDQRMYFSNTSTNFYHDHNGDWDAIPDYPLWD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G030260`
TK1151 ID	TkA01G030260
OH-1004 ID	LXL04_005637
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G030260

Location Chr01:7775708-7776274 (-)

Description Similar to ERF021: Ethylene-responsive transcription factor ERF021

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71450`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g33760`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g01250`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g11590`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g77200`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005637 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0060862 negative regulation of floral organ abscission Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G01250

ath:AT1G33760

ath:AT1G71450

ath:AT5G11590

ath:AT5G25810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.951

Rank 1 · TkA01G030260 · TK1151

Cytoplasm0.106

Rank 2 · TkA01G030260 · TK1151

Cell membrane0.031

Rank 3 · TkA01G030260 · TK1151

Endoplasmic reticulum0.026

Rank 4 · TkA01G030260 · TK1151

Plastid0.022

Rank 5 · TkA01G030260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP211-61 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G030260	`PF00847`	AP2	11	61	6.8e-15	55.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9I2`	Arabidopsis thaliana	sp\|Q9C9I2\|ERF21_ARATH Ethylene-responsive transcription factor ERF021	58.200%	Swiss-Prot	High
`Q9LQ28`	Arabidopsis thaliana	sp\|Q9LQ28\|ERF22_ARATH Ethylene-responsive transcription factor ERF022	58.400%	Swiss-Prot	High
`Q1ECI2`	Arabidopsis thaliana	sp\|Q1ECI2\|ERF23_ARATH Ethylene-responsive transcription factor ERF023	60.200%	Swiss-Prot	Low
`Q9LYD3`	Arabidopsis thaliana	sp\|Q9LYD3\|DREB3_ARATH Dehydration-responsive element-binding protein 3	60.900%	Swiss-Prot	Low
`O80654`	Arabidopsis thaliana	sp\|O80654\|ERF37_ARATH Ethylene-responsive transcription factor ERF037	62.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card