TkA01G009210 | RubberDandelionOmics

Gene overview

TkA01G009210

Reference: TK1151 Chr: Chr01 Coordinates: 2484120-2486414 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

975 bp · TkA01G009210|TK1151|cDNA

ATTATCCGAAAAAAGATGAAGCGGAAAATGCTTATCATCATTGCATTCGCATTACCAAAAAAAAGTCAAAGATGTATACCCAATATTTCAAGTTTTTTTAGTGGATCAAAATCAGATCTTCATCCGAAATTGATACTCAGAAGATTTGAGCTCAAGAGAAAAACATGGTACTGAAAGTTTATGCTGATCGAATATCCCAACCATCTCGTGCAATTCTCATTTTCTGCAAGATAAATGGGATAAATTTTGATGAAATCCGG...

CDS

Download CDS FASTA

729 bp · TkA01G009210|TK1151|CDS

ATGGTACTGAAAGTTTATGCTGATCGAATATCCCAACCATCTCGTGCAATTCTCATTTTCTGCAAGATAAATGGGATAAATTTTGATGAAATCCGGGTAGATATCTTGAAAAACCAGCAATTCTCTCCTGAATATAAGGCAATAAATCCCATGCATCAAGTTCCAGCAATAACTGATGGACGGTTTAAGCTGTTTGAGAGTCATGCAATTCTTATCTATTTATCTTGTGCATTTCCGGGAGTTGCTAGTCATTGGTATCC...

Protein

Download Protein FASTA

242 aa · TkA01G009210|TK1151|PROTEIN

MVLKVYADRISQPSRAILIFCKINGINFDEIRVDILKNQQFSPEYKAINPMHQVPAITDGRFKLFESHAILIYLSCAFPGVASHWYPGDLSKRAKIHSVLDWHHSNLRSGAAGFVFNAILAPLNGLPSSPQAGKEAEKILMKSLSKLETFWLKDGRFLVGSSQPSIADISLVCEIMQLQLLSEKECNRILSPYKKVLQWIEDTKKTTAPHFDEVHGVLFKAQKRIREQMTTKSGTNELKAKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G009210`
TK1151 ID	TkA01G009210
OH-1004 ID	LXL04_005895
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G009210

Location Chr01:2484120-2486414 (+)

Description Similar to GSTT1: Glutathione S-transferase T1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41210`	In vitro, possesses glutathione S-transferase activity toward 1-chloro-2,4-dinitrobenzene (CDNB) and p-nitrobenzyl chloride (pNBC), and glutathione peroxidase activity toward cumene hydroperoxide and linoleic acid-13-hydroperoxide.	Probing the diversity of the Arabidopsis glutathione S-transferase gene family.2002 · DOI: 10.1023/a:1015557300450
`UniProt: Q8L727`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release
`At5g41220`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005895 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006749 glutathione metabolic process Biological Process

GO:0009407 toxin catabolic process Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:1990830 cellular response to leukemia inhibitory factor Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0004364 glutathione transferase activity Molecular Function

GO:0004601 peroxidase activity Molecular Function

GO:0004602 glutathione peroxidase activity Molecular Function

KEGG gene cross-reference

ath:AT5G41210

ath:AT5G41220

ath:AT5G41240

mmu:14872

rno:29487

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.430

Rank 1 · TkA01G009210 · TK1151

Cytoplasm0.264

Rank 2 · TkA01G009210 · TK1151

Mitochondrion0.226

Rank 3 · TkA01G009210 · TK1151

Nucleus0.076

Rank 4 · TkA01G009210 · TK1151

Endoplasmic reticulum0.056

Rank 5 · TkA01G009210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02798GST_N1-74 aa

PF13417GST_N_36-80 aa

PF13409GST_N_214-74 aa

PF06528Phage_P2_GpE84-111 aa

PF13410GST_C_293-114 aa

PF22041GST_C_7127-188 aa

PF13410GST_C_2132-201 aa

PF00043GST_C132-200 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G009210	`PF02798`	GST_N	1	74	7.2e-12	46.2
TkA01G009210	`PF13417`	GST_N_3	6	80	7e-07	30.2
TkA01G009210	`PF13409`	GST_N_2	14	74	1.1e-07	33.0
TkA01G009210	`PF06528`	Phage_P2_GpE	84	111	0.25	11.6
TkA01G009210	`PF13410`	GST_C_2	93	114	8.8e-07	29.7
TkA01G009210	`PF22041`	GST_C_7	127	188	0.19	12.4
TkA01G009210	`PF13410`	GST_C_2	132	201	8.8e-07	29.7
TkA01G009210	`PF00043`	GST_C	132	200	0.0062	17.5
TkA01G009210	`PF14497`	GST_C_3	135	204	0.00041	21.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZRT5`	Arabidopsis thaliana	sp\|Q9ZRT5\|GSTT1_ARATH Glutathione S-transferase T1	67.200%	Swiss-Prot	High
`Q8L727`	Arabidopsis thaliana	sp\|Q8L727\|GSTT2_ARATH Glutathione S-transferase T2	67.700%	Swiss-Prot	High
`Q9FHE1`	Arabidopsis thaliana	sp\|Q9FHE1\|GSTT3_ARATH Glutathione S-transferase T3	65.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card