Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1988 bp · TkA01G008450|TK1151|cDNA
ATCATTTTCGTAAAAGCGATTAAATGTAACTATTTTTTTTATTTCATTAGTAAAAGTGGTTATATTAATTATTTTTAAGTTTACAAGTAATATATATCTTAACAAAATCTATAATATTATTTTTCAACGAAAATTCAATCACAATTATCACAAAAATGCAATCCATACTTCATTCGAGATTTGATTTTGGGTTTTCCCCCTTTCCATTGCTATTCCTTCTTACATCAATTCCCAGAAACTTCCCTATCACCTTCCGGACA...
1155 bp · TkA01G008450|TK1151|CDS
ATGGGTTGTGTTTGCTGCAAATTCCCATCATCTTTGTCTGATGGTGGTAAGAAAACCAAGCGGAAGAGACGAAAAACCGCAACAGCAGACGAGTTTTCACAAGTTATTCCGATCCCTTCTCACGATTTCAAGCTGGAGTGTGCTGCGCTTACACGACGTGGGTTTTACCCCGACACCCCCAATAAAGACAATCAAGATTCTTTCTGCATTAAAACAAGCATCCAAGGCAACCCCAATGTCCACATCTTCGGCGTTTTCGA...
Protein
Download Protein FASTA384 aa · TkA01G008450|TK1151|PROTEIN
MGCVCCKFPSSLSDGGKKTKRKRRKTATADEFSQVIPIPSHDFKLECAALTRRGFYPDTPNKDNQDSFCIKTSIQGNPNVHIFGVFDGHGHAGKQCSNFVKNRLIEILSTDETLIQDPVKAYTSAFSTTNTELHNNPDIDDSMSGTTAITVLVINDKLYVANVGDSRAVISVKGNQNRLISQDLSDDQTPYRNDECERVKHCGARVLSVDQVEGVKDPSVQSWGDEESSGSDPPRLWMQNAMYPGTAFTRSVGDSLAEKI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G008450 |
|---|---|
| TK1151 ID | TkA01G008450 |
| OH-1004 ID | LXL04_005903 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 99.740 / OH-1004 16.530Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G008450 | |||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:2219600-2221789 (+) | |||||||||||||||||||||
| Description | Similar to At3g06270: Probable protein phosphatase 2C 35 | |||||||||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| |||||||||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||||||||||||||
| GO annotations (OH1004 source) | GO:0007165 signal transduction Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0019677 NAD+ catabolic process Biological Process GO:0043068 positive regulation of programmed cell death Biological Process GO:0050832 defense response to fungus Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0003953 NAD+ nucleosidase activity Molecular Function GO:0004722 protein serine/threonine phosphatase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0043531 ADP binding Molecular Function GO:0046872 metal ion binding Molecular Function | |||||||||||||||||||||
| KEGG gene cross-reference | ath:AT3G06270 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13672PP2C_264-321 aaPF00481PP2C75-317 aaPF07228SpoIIE88-174 aaPF07228SpoIIE278-338 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G008450 | PF13672 | PP2C_2 | 64 | 321 | 2.9e-05 | 24.5 |
| TkA01G008450 | PF00481 | PP2C | 75 | 317 | 4.3e-39 | 135.4 |
| TkA01G008450 | PF07228 | SpoIIE | 88 | 174 | 0.0052 | 17.5 |
| TkA01G008450 | PF07228 | SpoIIE | 278 | 338 | 0.0052 | 17.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q7XJ53 | Arabidopsis thaliana | sp|Q7XJ53|P2C35_ARATH Probable protein phosphatase 2C 35 | 63.100% | Swiss-Prot | High |
Q9SL76 | Arabidopsis thaliana | sp|Q9SL76|P2C19_ARATH Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein | 57.300% | Swiss-Prot | High |
Q8GY60 | Arabidopsis thaliana | sp|Q8GY60|P2C52_ARATH Probable protein phosphatase 2C 52 | 26.200% | Swiss-Prot | Low |
Q8H2T0 | Oryza sativa subsp. japonica | sp|Q8H2T0|P2C65_ORYSJ Probable protein phosphatase 2C 65 | 51.600% | Swiss-Prot | High |
Q8H4S6 | Oryza sativa subsp. japonica | sp|Q8H4S6|P2C64_ORYSJ Probable protein phosphatase 2C 64 | 29.100% | Swiss-Prot | Low |