TkA01G006340 | RubberDandelionOmics

Gene overview

TkA01G006340

Reference: TK1151 Chr: Chr01 Coordinates: 1640979-1643125 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1519 bp · TkA01G006340|TK1151|cDNA

CTTCTGCATTAAATGTGAGTGTTAGCTACTACAGAATCATTAGACCGTTTGCTGAAACTGCTCTTGAATGTGATCCAAATGAGAAGGCAGTAGATAAAAAAGCAGAATGGGTTTGTGACAGCCCTGTGAATTCTCAAGTAGAGAAGAAACTTCGGGATTTGTTAGTTAAATTGGGGAAGGCTGATAGAATACTTGGAATTCAGTTTATTTCTGTTAGGTTTGTGCCTACAAAGATGGTGAAGTAATAATTGACACAGCTG...

CDS

Download CDS FASTA

1503 bp · TkA01G006340|TK1151|CDS

TCTGCATTAAATGTGAGTGTTAGCTACTACAGAATCATTAGACCGTTTGCTGAAACTGCTCTTGAATGTGATCCAAATGAGAAGGCAGTAGATAAAAAAGCAGAATGGGTTTGTGACAGCCCTGTGAATTCTCAAGTAGAGAAGAAACTTCGGGATTTGTTAGTTAAATTGGGGAAGGCTGATAGAATACTTGGAATTCAGGTTTGTGCCTACAAAGATGGTGAAGTAATAATTGACACAGCTGCTGGTGTACTTGGAAA...

Protein

Download Protein FASTA

501 aa · TkA01G006340|TK1151|PROTEIN

SALNVSVSYYRIIRPFAETALECDPNEKAVDKKAEWVCDSPVNSQVEKKLRDLLVKLGKADRILGIQVCAYKDGEVIIDTAAGVLGNYDSSPVQPDTLFPVFSVTKGVTAGMLHWLVDKGKVRLEDNVADIWPDFSSNRKESIKVHHVLNHTSGMQNALASLVQDNPMVLCNWEECLKRIAMSEAESEPGQDQQYHYLSYGWLCGGIIEHASKKKFQNILEEAFIHPLKIEGELYIGIPPGVESRLATLTLDTNDLNRFA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G006340`
TK1151 ID	TkA01G006340
OH-1004 ID	LXL04_005932
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.200
Protein coverage (%)	TK1151 100.000 / OH-1004 58.851 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G006340`
Location	Chr01:1640979-1643125 (+)
Description	Similar to ABC1K8: Protein ACTIVITY OF BC1 COMPLEX KINASE 8, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005932` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006979 response to oxidative stress Biological Process GO:0007005 mitochondrion organization Biological Process GO:0007623 circadian rhythm Biological Process GO:0009644 response to high light intensity Biological Process GO:0010150 leaf senescence Biological Process GO:0010637 negative regulation of mitochondrial fusion Biological Process GO:0034599 cellular response to oxidative stress Biological Process GO:0042542 response to hydrogen peroxide Biological Process GO:0046467 membrane lipid biosynthetic process Biological Process GO:0046686 response to cadmium ion Biological Process GO:0055088 lipid homeostasis Biological Process GO:1901031 regulation of response to reactive oxygen species Biological Process
KEGG gene cross-reference	ath:AT5G64940 ddi:DDB_G0281799 gga:423382 hsa:57143 mmu:72113 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.503

Rank 1 · TkA01G006340 · TK1151

Nucleus0.279

Rank 2 · TkA01G006340 · TK1151

Mitochondrion0.134

Rank 3 · TkA01G006340 · TK1151

Peroxisome0.108

Rank 4 · TkA01G006340 · TK1151

Plastid0.091

Rank 5 · TkA01G006340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00144Beta-lactamase51-348 aa

PF10409PTEN_C2351-405 aa

PF00144Beta-lactamase420-472 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G006340	`PF00144`	Beta-lactamase	51	348	5e-46	158.1
TkA01G006340	`PF10409`	PTEN_C2	351	405	0.079	13.4
TkA01G006340	`PF00144`	Beta-lactamase	420	472	5e-46	158.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card