TkA01G004130 | RubberDandelionOmics

Gene overview

TkA01G004130

Reference: TK1151 Chr: Chr01 Coordinates: 1083037-1083342 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

306 bp · TkA01G004130|TK1151|cDNA

ATGGGAGCGGCGTACGGGACGACGAAGAGTGGCGTTGGTGTCGCATCGATGGGAGTGATGAGGCCGGAGCTGGTTATGAAGTCGATTGTGCCGGTTGTTATGGCGGGAGTGTTAGGTATTTACGGATTGATTATTGCTGTTATTATTAGTACCGGAATCAATCCAAAGGCGAAATCGTATTACTTATTTGACGGTTACGCGCATCTGTCATCTGGCCTTGCTTGTGGTCTCGCTGGACTTTCCGCTGGAATGGCCATTGG...

CDS

Download CDS FASTA

306 bp · TkA01G004130|TK1151|CDS

ATGGGAGCGGCGTACGGGACGACGAAGAGTGGCGTTGGTGTCGCATCGATGGGAGTGATGAGGCCGGAGCTGGTTATGAAGTCGATTGTGCCGGTTGTTATGGCGGGAGTGTTAGGTATTTACGGATTGATTATTGCTGTTATTATTAGTACCGGAATCAATCCAAAGGCGAAATCGTATTACTTATTTGACGGTTACGCGCATCTGTCATCTGGCCTTGCTTGTGGTCTCGCTGGACTTTCCGCTGGAATGGCCATTGG...

Protein

Download Protein FASTA

101 aa · TkA01G004130|TK1151|PROTEIN

MGAAYGTTKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRYNLLLH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G004130`
TK1151 ID	TkA01G004130
OH-1004 ID	LXL04_005966
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.900
Protein coverage (%)	TK1151 96.040 / OH-1004 62.987 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G004130

Location Chr01:1083037-1083342 (+)

Description Similar to CVA16-2: V-type proton ATPase 16 kDa proteolipid subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34720`	Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase.	No verified direct reference in this release
`At4g38920`	Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase.	No verified direct reference in this release
`At2g16510`	Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase.	No verified direct reference in this release
`At1g19910`	Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005966 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000220 vacuolar proton-transporting V-type ATPase, V0 domain Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0033179 proton-transporting V-type ATPase, V0 domain Cellular Component

GO:0046961 proton-transporting ATPase activity, rotational mechanism Molecular Function

KEGG gene cross-reference

ath:AT1G19910

ath:AT2G16510

ath:AT4G34720

ath:AT4G38920

ghi:107903720

ghi:107909439

ghi:107920550

ghi:107936576

ghi:107949088

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.356

Rank 1 · TkA01G004130 · TK1151

Endoplasmic reticulum0.288

Rank 2 · TkA01G004130 · TK1151

Cytoplasm0.193

Rank 3 · TkA01G004130 · TK1151

Peroxisome0.091

Rank 4 · TkA01G004130 · TK1151

Lysosome / Vacuole0.075

Rank 5 · TkA01G004130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00137ATP-synt_C1-49 aa

PF26629GT2_TM_C16-50 aa

PF11628TCR_zetazeta36-46 aa

PF26629GT2_TM_C49-89 aa

PF00137ATP-synt_C70-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G004130	`PF00137`	ATP-synt_C	1	49	8.5e-16	58.7
TkA01G004130	`PF26629`	GT2_TM_C	16	50	0.03	15.1
TkA01G004130	`PF11628`	TCR_zetazeta	36	46	3.0	8.4
TkA01G004130	`PF26629`	GT2_TM_C	49	89	0.03	15.1
TkA01G004130	`PF00137`	ATP-synt_C	70	94	8.5e-16	58.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DH92`	Arabidopsis thaliana	sp\|P0DH92\|VATL1_ARATH V-type proton ATPase subunit c1	96.900%	Swiss-Prot	High
`P0DH93`	Arabidopsis thaliana	sp\|P0DH93\|VATL3_ARATH V-type proton ATPase subunit c3	96.900%	Swiss-Prot	High
`P0DH94`	Arabidopsis thaliana	sp\|P0DH94\|VATL5_ARATH V-type proton ATPase subunit c5	96.900%	Swiss-Prot	High
`P59228`	Arabidopsis thaliana	sp\|P59228\|VATL2_ARATH V-type proton ATPase subunit c2	96.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card