TkA01G004090 | RubberDandelionOmics

Gene overview

TkA01G004090

Reference: TK1151 Chr: Chr01 Coordinates: 1070353-1073960 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1570 bp · TkA01G004090|TK1151|cDNA

ATCTCATCGAACCCATCCATCCCAACACCCCCACCCACCATCAATTTGCGCTAAATCCACCTAACACCTTGTTCAAATTGGTGCAAGTTGAACTCTACCTAACCCCTTGTTTAAATTAGCTCAAGTTGAACGAATGCTCAACACTGATTTCTGACATACACCATCATATTTCGAAGTTTGTGTATGTGTGGTTAGATGAGGACTGAATTAAGCGGTGCCGCTGCCGGAGAAGCATGGAAGGCACACACCGCCATGGCGTT...

CDS

Download CDS FASTA

855 bp · TkA01G004090|TK1151|CDS

ATGACTAGGCAGTTTCTCATGTATTTCTTCTTTCTTGGGTTGACTGGAATATTTGGGAACCAGCTTTTGTTTCTTATTGGTCTAGGCTACACAAATCCAACATATGCTGCAGCAATTCAACCTTCAATTCCAGTCTTCACTTTCATATTCGCTGTATTGATGGGTGCAGAAACAATAAATGTGCTCAAAATTGAAGGTCAGGCAAAAGTTGCAGGCACAATTGTTTGTGTTTCTGGTGCCATCTTGATGGTTATCTTCAA...

Protein

Download Protein FASTA

284 aa · TkA01G004090|TK1151|PROTEIN

MTRQFLMYFFFLGLTGIFGNQLLFLIGLGYTNPTYAAAIQPSIPVFTFIFAVLMGAETINVLKIEGQAKVAGTIVCVSGAILMVIFKGPALLGYAANVPDLIPGGQPEVSGGIFSGLDNWHIGVLCLIANCICMAAFLAVQAPVLAKYPANLSVTAYTYFFGTIFMVVTAVATKNESMNWSLTGSEVLAVIYAGTITSALCYGLLTWSNKMLGPALVSLYNPLQPAASAFLSKVFLGDPIYLGSIFGGLLIIAGLYVVTW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G004090`
TK1151 ID	TkA01G004090
OH-1004 ID	LXL04_005968
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.500
Protein coverage (%)	TK1151 94.366 / OH-1004 71.850 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G004090

Location Chr01:1070353-1073960 (+)

Description Similar to At5g45370: WAT1-related protein At5g45370

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g45870`	WAT1-related protein At3g45870.	No verified direct reference in this release
`At4g19185`	WAT1-related protein At4g19185.	No verified direct reference in this release
`At5g45370`	WAT1-related protein At5g45370.	No verified direct reference in this release
`At1g75500`	Required for secondary wall formation in fibers, especially in short days conditions.	Walls are thin 1 (WAT1), an Arabidopsis homolog of Medicago truncatula NODULIN21, is a tonoplast-localized protein required for secondary wall formation in fibers.2010 · DOI: 10.1111/j.1365-313x.2010.04256.x Light-regulated compensation of wat1 (walls are thin1) growth and secondary cell wall phenotypes is auxin-independent.2010 · DOI: 10.4161/psb.5.10.13103 Arabidopsis wat1 (walls are thin1)-mediated resistance to the bacterial vascular pathogen, Ralstonia solanacearum, is accompanied by cross-regulation of salicylic acid and tryptophan metabolism.2013 · DOI: 10.1111/tpj.12027

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005968 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000162 L-tryptophan biosynthetic process Biological Process

GO:0006952 defense response Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0009851 auxin biosynthetic process Biological Process

GO:0010315 auxin export across the plasma membrane Biological Process

GO:0071555 cell wall organization Biological Process

GO:0090355 positive regulation of auxin metabolic process Biological Process

GO:0090358 positive regulation of L-tryptophan metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G75500

ath:AT3G45870

ath:AT4G19185

ath:AT5G45370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.327

Rank 1 · TkA01G004090 · TK1151

Lysosome / Vacuole0.318

Rank 2 · TkA01G004090 · TK1151

Endoplasmic reticulum0.169

Rank 3 · TkA01G004090 · TK1151

Golgi apparatus0.104

Rank 4 · TkA01G004090 · TK1151

Cytoplasm0.085

Rank 5 · TkA01G004090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892EamA7-84 aa

PF22954DUF702746-86 aa

PF19865DUF6338115-115 aa

PF00892EamA122-259 aa

PF22954DUF7027157-217 aa

PF19865DUF6338183-262 aa

PF22954DUF7027251-279 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G004090	`PF00892`	EamA	7	84	3.4e-24	86.4
TkA01G004090	`PF22954`	DUF7027	46	86	0.47	11.1
TkA01G004090	`PF19865`	DUF6338	115	115	0.038	14.3
TkA01G004090	`PF00892`	EamA	122	259	3.4e-24	86.4
TkA01G004090	`PF22954`	DUF7027	157	217	0.47	11.1
TkA01G004090	`PF19865`	DUF6338	183	262	0.038	14.3
TkA01G004090	`PF22954`	DUF7027	251	279	0.47	11.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5PP32`	Arabidopsis thaliana	sp\|Q5PP32\|WTR25_ARATH WAT1-related protein At3g45870	69.600%	Swiss-Prot	High
`Q8W4R9`	Arabidopsis thaliana	sp\|Q8W4R9\|WTR35_ARATH WAT1-related protein At4g19185	65.600%	Swiss-Prot	High
`F4KD68`	Arabidopsis thaliana	sp\|F4KD68\|WTR43_ARATH WAT1-related protein At5g45370	68.000%	Swiss-Prot	High
`Q94AP3`	Arabidopsis thaliana	sp\|Q94AP3\|WAT1_ARATH Protein WALLS ARE THIN 1	37.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card