TkA01G003040 | RubberDandelionOmics

Gene overview

TkA01G003040

Reference: TK1151 Chr: Chr01 Coordinates: 792049-795165 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2034 bp · TkA01G003040|TK1151|cDNA

AAAAGAATGAAAAGCGTGTGATCGTCTATAAATGAAGCCACGTAGAGATTCAGAGCAACGCAAATTCTTCATATCAACCACCATTCCAACATTCCCACGAGGGTGATTACCCTATCGGCAAACACTCTCATTCTCCGACGTTTAAATATATTCCGAGGTTTGTTATCGGCGCCGTGATGGCTGGGCAATCCCGTAAATGGATGATCCTGATGGCGACCATATGGATCCAGGCCTTCACCGGTACCAATTTCGACTTCTCG...

CDS

Download CDS FASTA

1620 bp · TkA01G003040|TK1151|CDS

ATGGCTGGGCAATCCCGTAAATGGATGATCCTGATGGCGACCATATGGATCCAGGCCTTCACCGGTACCAATTTCGACTTCTCGGCTTACTCATCGGAGCTTAAGAAGGTCCTGGATGTGTCGCAGGTTCAATTGAACTACCTCGCCACCGCCTCCGACTTAGGGAAAGCCTTTGGGTGGTCGTCGGGACTGGCGCTTATGTATTTGCCGATATGGATGGTAATGTTCATCGCGGCTTTCATGGGGTTATTCGGTTACGG...

Protein

Download Protein FASTA

539 aa · TkA01G003040|TK1151|PROTEIN

MAGQSRKWMILMATIWIQAFTGTNFDFSAYSSELKKVLDVSQVQLNYLATASDLGKAFGWSSGLALMYLPIWMVMFIAAFMGLFGYGVQWLLIRRIISLPYFPVFLLCLLAGCSICWFNTFCFVICTQNFPTNRPLAISLTVSFNGVSAALYNLAAKAINPSSYSLYLLLNAFIPLFTSFAALIPILRQPPSNPIPATTIRHDRLIFIILYIFAIITGLYLVVIPPNPAKLLFSGALGLLILPLGVPGIVYARSWFSDNV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G003040`
TK1151 ID	TkA01G003040
OH-1004 ID	LXL04_005985
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G003040

Location Chr01:792049-795165 (+)

Description Similar to NFD4: Protein NUCLEAR FUSION DEFECTIVE 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31470`	Required for karyogamy during female gametophyte development, when the two polar nuclei fuse to form the diploid central cell nucleus.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005985 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000741 karyogamy Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0016020 membrane Cellular Component

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G31470

yli:2906009

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.479

Rank 1 · TkA01G003040 · TK1151

Cell membrane0.235

Rank 2 · TkA01G003040 · TK1151

Endoplasmic reticulum0.156

Rank 3 · TkA01G003040 · TK1151

Cytoplasm0.111

Rank 4 · TkA01G003040 · TK1151

Golgi apparatus0.102

Rank 5 · TkA01G003040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06813Nodulin-like7-225 aa

PF07690MFS_120-255 aa

PF23262NFD4_C91-144 aa

PF23262NFD4_C315-526 aa

PF07690MFS_1335-525 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G003040	`PF06813`	Nodulin-like	7	225	2e-77	260.8
TkA01G003040	`PF07690`	MFS_1	20	255	4.5e-05	23.2
TkA01G003040	`PF23262`	NFD4_C	91	144	1.9e-53	182.2
TkA01G003040	`PF23262`	NFD4_C	315	526	1.9e-53	182.2
TkA01G003040	`PF07690`	MFS_1	335	525	4.5e-05	23.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I9E1`	Arabidopsis thaliana	sp\|F4I9E1\|NFD4_ARATH Protein NUCLEAR FUSION DEFECTIVE 4	55.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card