TkA01G001980 | RubberDandelionOmics

Gene overview

TkA01G001980

Reference: TK1151 Chr: Chr01 Coordinates: 529592-534177 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2462 bp · TkA01G001980|TK1151|cDNA

CGTGCTTAATTAATCAATTATTTTTAAGTTCCTTGTGAAATTTTAATTTTAAACTTTTGATTACTTCAACTTCATCATCATTTGTAAATTGCAGGTTAAAAATCTTTGGGCCAGTTGCAATTGCGGCTTTCTTGGTTCTTATTCCAGTGAATGTATCGGGTGGGATGCTGTTTTTTTCTCAGCAAGGAGTTGGTCATCAGTGACATTGATAAGCTTTCAATATCAAATGTTCAACCAAAATCTCCAAAATTTTTGGCACA...

CDS

Download CDS FASTA

1197 bp · TkA01G001980|TK1151|CDS

ATGGTGGAGCGTGAGAGACTTCTCAAGGACCCAAAACGCATTATGCCGGCAGCATTTGTATCCTTCAAGTCGCGGTGGGGTGCGGCGGTGTGTGCGCAGACGCAACAAAGCAAAAACCCGATTCTGTGGTTAACAAATTGGGCTCCTGAACCTCGAGATGTCTACTGGAAAAATCTGGCTATACCCTTTGTATCTCTGAGCATCCGTAAACTAGTTATATCATTAGCGGTATTTGCACTAGTCTTCTTCTACATCATACC...

Protein

Download Protein FASTA

398 aa · TkA01G001980|TK1151|PROTEIN

MVERERLLKDPKRIMPAAFVSFKSRWGAAVCAQTQQSKNPILWLTNWAPEPRDVYWKNLAIPFVSLSIRKLVISLAVFALVFFYIIPIAFVQSLANLDGLERVVPFLRPVLEWSFIKSFLQGFLPGLALKVFLWLLPGILMTMSKIEGHVAFSVLERRTAGKYYLFMLVNVFLGSIATGTAFEQLHSFLNQSPTQIPRTIGVSIPMKATFFITYIMVDGWAGMAGEILRLKPLIMFHLKNMLIVKTKRDREKAMNPKGID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G001980`
TK1151 ID	TkA01G001980
OH-1004 ID	LXL04_029218
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	85.900
Protein coverage (%)	TK1151 92.714 / OH-1004 44.727 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G001980

Location Chr01:529592-534177 (-)

Description Similar to At1g32090: CSC1-like protein At1g32090

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32090`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release
`At3g21620`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release
`At4g04340`	May act as a hyperosmolarity-gated nonselective cation channel permeable to Ca²⁺.	OSCA1 mediates osmotic-stress-evoked Ca2+ increases vital for osmosensing in Arabidopsis.2014 · DOI: 10.1038/nature13593 OSCA/TMEM63 are an Evolutionarily Conserved Family of Mechanically Activated Ion Channels.2018 · DOI: 10.7554/elife.41844
`At4g22120`	Acts as an osmosensitive calcium-permeable cation channel.	OSCA/TMEM63 are an Evolutionarily Conserved Family of Mechanically Activated Ion Channels.2018 · DOI: 10.7554/elife.41844 Structure-guided mutagenesis of OSCAs reveals differential activation to mechanical stimuli.2024 · DOI: 10.7554/elife.93147
`At4g02900`	Calcium-permeable channel involved in plant stomatal immunity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029218 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006812 monoatomic cation transport Biological Process

GO:0010118 stomatal movement Biological Process

GO:0045087 innate immune response Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005227 calcium-activated cation channel activity Molecular Function

GO:0005262 calcium channel activity Molecular Function

KEGG gene cross-reference

ath:AT1G11960

ath:AT1G32090

ath:AT3G21620

ath:AT4G02900

ath:AT4G22120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.814

Rank 1 · TkA01G001980 · TK1151

Cytoplasm0.135

Rank 2 · TkA01G001980 · TK1151

Endoplasmic reticulum0.068

Rank 3 · TkA01G001980 · TK1151

Lysosome / Vacuole0.047

Rank 4 · TkA01G001980 · TK1151

Mitochondrion0.042

Rank 5 · TkA01G001980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14703PHM7_cyt4-58 aa

PF02714RSN1_7TM69-341 aa

PF14703PHM7_cyt383-394 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G001980	`PF14703`	PHM7_cyt	4	58	3.9e-13	50.7
TkA01G001980	`PF02714`	RSN1_7TM	69	341	9.9e-83	278.4
TkA01G001980	`PF14703`	PHM7_cyt	383	394	3.9e-13	50.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FVQ5`	Arabidopsis thaliana	sp\|Q9FVQ5\|OSC18_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.8	78.600%	Swiss-Prot	High
`Q9LVE4`	Arabidopsis thaliana	sp\|Q9LVE4\|OSC15_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.5	67.100%	Swiss-Prot	High
`Q9XEA1`	Arabidopsis thaliana	sp\|Q9XEA1\|OSC11_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.1	66.800%	Swiss-Prot	High
`Q5XEZ5`	Arabidopsis thaliana	sp\|Q5XEZ5\|OSC12_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.2	67.400%	Swiss-Prot	High
`Q9SY14`	Arabidopsis thaliana	sp\|Q9SY14\|OSC17_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.7	66.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card