TkA01G000430 | RubberDandelionOmics

Gene overview

TkA01G000430

Reference: TK1151 Chr: Chr01 Coordinates: 98482-98919 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

438 bp · TkA01G000430|TK1151|cDNA

CAAAATCAATGTGGGAACTTAACCATTCCATATCCCTTCGGTGTCGGTCCTGGCTGCTTTCTAAGCCGATGGTTCGAAATCACCTGCAACACTACTTTTAATCCTCCCAAACCCTTCATCGGCGGTCTCTCAGTAATAGAAATCACGGACTCTACTTTCCGTGTAGCTAACGAAGTGGCTAGCAGATGTTACGATCAATTTGGAAATATAACGGAAGACGATCATGTAACCACAAATATCGGGTGGACATCACCGTTCAC...

CDS

Download CDS FASTA

438 bp · TkA01G000430|TK1151|CDS

CAAAATCAATGTGGGAACTTAACCATTCCATATCCCTTCGGTGTCGGTCCTGGCTGCTTTCTAAGCCGATGGTTCGAAATCACCTGCAACACTACTTTTAATCCTCCCAAACCCTTCATCGGCGGTCTCTCAGTAATAGAAATCACGGACTCTACTTTCCGTGTAGCTAACGAAGTGGCTAGCAGATGTTACGATCAATTTGGAAATATAACGGAAGACGATCATGTAACCACAAATATCGGGTGGACATCACCGTTCAC...

Protein

Download Protein FASTA

145 aa · TkA01G000430|TK1151|PROTEIN

QNQCGNLTIPYPFGVGPGCFLSRWFEITCNTTFNPPKPFIGGLSVIEITDSTFRVANEVASRCYDQFGNITEDDHVTTNIGWTSPFTFSQQNQFTLIGCNDVAMFQGPPQVNFTSGCIALCTQPDQVSKGSCDGVGCVGFGGENW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G000430`
TK1151 ID	TkA01G000430
OH-1004 ID	LXL04_019143
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 94.483 / OH-1004 7.883 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G000430

Location Chr01:98482-98919 (-)

Description Similar to WAK2: Wall-associated receptor kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16260`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g69730`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g79680`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g19390`	Putative serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At4g31100`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019143 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0009311 oligosaccharide metabolic process Biological Process

GO:0009615 response to virus Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009992 intracellular water homeostasis Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G21240

ath:AT1G21250

ath:AT1G21270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.428

Rank 1 · TkA01G000430 · TK1151

Extracellular0.271

Rank 2 · TkA01G000430 · TK1151

Endoplasmic reticulum0.111

Rank 3 · TkA01G000430 · TK1151

Cytoplasm0.103

Rank 4 · TkA01G000430 · TK1151

Lysosome / Vacuole0.062

Rank 5 · TkA01G000430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13947GUB_WAK_bind2-51 aa

PF13947GUB_WAK_bind94-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G000430	`PF13947`	GUB_WAK_bind	2	51	3.7e-08	34.4
TkA01G000430	`PF13947`	GUB_WAK_bind	94	94	3.7e-08	34.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA25`	Arabidopsis thaliana	sp\|Q9SA25\|WAKLG_ARATH Wall-associated receptor kinase-like 8	28.600%	Swiss-Prot	Low
`Q9C9L5`	Arabidopsis thaliana	sp\|Q9C9L5\|WAKLH_ARATH Wall-associated receptor kinase-like 9	31.900%	Swiss-Prot	Medium
`Q8VYA3`	Arabidopsis thaliana	sp\|Q8VYA3\|WAKLJ_ARATH Wall-associated receptor kinase-like 10	28.800%	Swiss-Prot	Low
`Q9LN59`	Arabidopsis thaliana	sp\|Q9LN59\|WAKLK_ARATH Putative wall-associated receptor kinase-like 11	31.700%	Swiss-Prot	Medium
`Q9M092`	Arabidopsis thaliana	sp\|Q9M092\|WAKLM_ARATH Wall-associated receptor kinase-like 17	32.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card