LXL04_038874 | RubberDandelionOmics

Gene overview

LXL04_038874

Reference: OH-1004 Chr: Chr09 Coordinates: 52276969-52279035 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

965 bp · LXL04_038874|LXL04_038874|OH1004|cDNA

ATGTGTAGTAGCCGACTTCACTCTTCCTTTTCGGGTGAAATCAAATCACCTGTAAAAAGCAAAGCAAAGCAGCATCCTCTAAaatcaaaaccaaccaaaccGCCCCCAATCGCTCTCGTCCCCATCCATTTCCCGACGCATCCCCAATTCCTAAGCTTCATCTGCAATTTCAATTTCTCCTCAAATCCAACCGTAAACCCTAACTCAATTTCGATTCAACATCTCCCACTGTCAATCATGGACGCTGACTCTTGGGCTGC...

CDS

Download CDS FASTA

903 bp · LXL04_038874|LXL04_038874|OH1004|CDS

ATGTGTAGTAGCCGACTTCACTCTTCCTTTTCGGGTGAAATCAAATCACCTGTAAAAAGCAAAGCAAAGCAGCATCCTCTAAAATCAAAACCAACCAAACCGCCCCCAATCGCTCTCGTCCCCATCCATTTCCCGACGCATCCCCAATTCCTAAGCTTCATCTGCAATTTCAATTTCTCCTCAAATCCAACCGTAAACCCTAACTCAATTTCGATTCAACATCTCCCACTGTCAATCATGGACGCTGACTCTTGGGCTGC...

Protein

Download Protein FASTA

300 aa · LXL04_038874|LXL04_038874|OH1004|PROTEIN

MCSSRLHSSFSGEIKSPVKSKAKQHPLKSKPTKPPPIALVPIHFPTHPQFLSFICNFNFSSNPTVNPNSISIQHLPLSIMDADSWAARLSSTSKRYQYALQSRSSDMFMGFEDIEVDDDIREEYPCPFCTGYFDVVGLCCHIDDEHHVEAKNGVCPVCAVRVGVDMVAHITLQHGNIFKMQQKRKCRKGSSVSTLSLLRRELREGNLQSLFGGSSYIVPSANAAPDPLLSSFILPIGDDLGTTQSNSSAESVAVTKSTSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038874`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038874

Location Chr09:52276969-52279035 (+)

Description Similar to DI19-3: Protein DEHYDRATION-INDUCED 19 homolog 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05700`	Protein DEHYDRATION-INDUCED 19 homolog 3.	No verified direct reference in this release
`At5g26990`	Protein DEHYDRATION-INDUCED 19 homolog 6.	No verified direct reference in this release
`At1g56280`	Protein DEHYDRATION-INDUCED 19.	No verified direct reference in this release
`At5g49230`	Involved in both red and blue light signaling.	HYPERSENSITIVE TO RED AND BLUE 1, a ZZ-type zinc finger protein, regulates phytochrome B-mediated red and cryptochrome-mediated blue light responses.2005 · DOI: 10.1105/tpc.104.029165

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0358000`	Protein DEHYDRATION-INDUCED 19 homolog 2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038874 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009785 blue light signaling pathway Biological Process

GO:0010161 red light signaling pathway Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G56280

ath:AT3G05700

ath:AT5G26990

ath:AT5G49230

dosa:Os05g0358000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.843

Rank 1 · LXL04_038874 · OH-1004

Cytoplasm0.230

Rank 2 · LXL04_038874 · OH-1004

Cell membrane0.031

Rank 3 · LXL04_038874 · OH-1004

Endoplasmic reticulum0.028

Rank 4 · LXL04_038874 · OH-1004

Mitochondrion0.015

Rank 5 · LXL04_038874 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05605.19zf-Di19122-175 aa

PF14571.12Di19_C195-295 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038874	`PF05605.19`	zf-Di19	122	175	2.9e-23	82.6
LXL04_038874	`PF14571.12`	Di19_C	195	295	8.5e-37	126.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84J70`	Arabidopsis thaliana	Protein DEHYDRATION-INDUCED 19 homolog 3	58.929%	Swiss-Prot	strong database homology
`Q6NM26`	Arabidopsis thaliana	Protein DEHYDRATION-INDUCED 19 homolog 6	54.260%	Swiss-Prot	strong database homology
`Q39083`	Arabidopsis thaliana	Protein DEHYDRATION-INDUCED 19	52.703%	Swiss-Prot	strong database homology
`Q9FJ17`	Arabidopsis thaliana	Protein DEHYDRATION-INDUCED 19 homolog 7	46.154%	Swiss-Prot	moderate database homology
`Q5W794`	Oryza sativa subsp. japonica	Protein DEHYDRATION-INDUCED 19 homolog 2	49.763%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card