LXL04_038680 | RubberDandelionOmics

Gene overview

LXL04_038680

Reference: OH-1004 Chr: Chr09 Coordinates: 47984130-47986104 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

849 bp · LXL04_038680|LXL04_038680|OH1004|cDNA

ATGGCTACTAACCAAACCAATTTCTGCGTTCCAATTCCCGAAGATCAATGTGATCATCCAACGCAATTCCAAGCCATGTCAACCGAAGAAGACATTGATTACTCACAAAGAGGACAATGGCTTCGTGCGGCTGTACTAGGAGCCAACGATGGCTTGGTTTCCGTTGCATCTCTGATGATGGGTGTTGGAGCTGTGAAACACGACTCCAAAGCCATGATTCTTTCTGGGTTTGCGGGTCTAGTTGCAGGTGCATGCAGTAT...

CDS

Download CDS FASTA

849 bp · LXL04_038680|LXL04_038680|OH1004|CDS

ATGGCTACTAACCAAACCAATTTCTGCGTTCCAATTCCCGAAGATCAATGTGATCATCCAACGCAATTCCAAGCCATGTCAACCGAAGAAGACATTGATTACTCACAAAGAGGACAATGGCTTCGTGCGGCTGTACTAGGAGCCAACGATGGCTTGGTTTCCGTTGCATCTCTGATGATGGGTGTTGGAGCTGTGAAACACGACTCCAAAGCCATGATTCTTTCTGGGTTTGCGGGTCTAGTTGCAGGTGCATGCAGTAT...

Protein

Download Protein FASTA

282 aa · LXL04_038680|LXL04_038680|OH1004|PROTEIN

MATNQTNFCVPIPEDQCDHPTQFQAMSTEEDIDYSQRGQWLRAAVLGANDGLVSVASLMMGVGAVKHDSKAMILSGFAGLVAGACSMAIGEFVSVYSQLDVEVAQMKRDGNHEKKEKEELPNPMQAAVASALAFTLGAIVPLLAASFIEDHKLRLGMVVAAVSFALVLFGWASSILGGTPVFKSCFRVLLGGVMAMGITFGLTKLIGSSDTFIVRDIVPLEIQSNKKPTTRNQTHNTRSDWKSIETRKSLPVVDFLQWID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038680`
TK1151 ID	TkA04G454940
OH-1004 ID	LXL04_038680
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.500
Protein coverage (%)	TK1151 98.773 / OH-1004 65.248 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038680

Location Chr09:47984130-47986104 (+)

Description Similar to At3g43660: Vacuolar iron transporter homolog 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g43660`	Probable vacuolar iron transporter that may be involved in the regulation of iron distribution throughout the plant.	No verified direct reference in this release
`At1g21140`	Vacuolar iron transporter involved in the transfer of iron ions from the cytosol to the vacuole for intracellular iron storage.	Vacuolar-Iron-Transporter1-Like proteins mediate iron homeostasis in Arabidopsis.2014 · DOI: 10.1371/journal.pone.0110468
`At3g43630`	Probable vacuolar iron transporter that may be involved in the regulation of iron distribution throughout the plant.	Members of a small family of nodulin-like genes are regulated under iron deficiency in roots of Arabidopsis thaliana.2011 · DOI: 10.1016/j.plaphy.2011.02.011
`At1g76800`	Vacuolar iron transporter involved in the transfer of iron ions from the cytosol to the vacuole for intracellular iron storage.	Vacuolar-Iron-Transporter1-Like proteins mediate iron homeostasis in Arabidopsis.2014 · DOI: 10.1371/journal.pone.0110468

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038680 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0009877 nodulation Biological Process

GO:0010039 response to iron ion Biological Process

GO:0030026 intracellular manganese ion homeostasis Biological Process

GO:0005774 vacuolar membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005381 iron ion transmembrane transporter activity Molecular Function

GO:0005384 manganese ion transmembrane transporter activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G21140

ath:AT1G76800

ath:AT3G43630

ath:AT3G43660

gmx:100791523

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.345

Rank 1 · LXL04_038680 · OH-1004

Lysosome / Vacuole0.284

Rank 2 · LXL04_038680 · OH-1004

Endoplasmic reticulum0.202

Rank 3 · LXL04_038680 · OH-1004

Cytoplasm0.127

Rank 4 · LXL04_038680 · OH-1004

Golgi apparatus0.118

Rank 5 · LXL04_038680 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01988.25VIT141-115 aa

PF01988.25VIT1116-203 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038680	`PF01988.25`	VIT1	41	115	4.2e-41	141.8
LXL04_038680	`PF01988.25`	VIT1	116	203	4.2e-41	141.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2C0`	Arabidopsis thaliana	Vacuolar iron transporter homolog 4	63.462%	Swiss-Prot	strong database homology
`Q9LPU9`	Arabidopsis thaliana	Vacuolar iron transporter homolog 1	72.678%	Swiss-Prot	moderate database homology
`Q9M2C3`	Arabidopsis thaliana	Vacuolar iron transporter homolog 3	69.355%	Swiss-Prot	moderate database homology
`Q9SRD3`	Arabidopsis thaliana	Vacuolar iron transporter homolog 2	66.839%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card