LXL04_038573 | RubberDandelionOmics

Gene overview

LXL04_038573

Reference: OH-1004 Chr: Chr09 Coordinates: 44231469-44234637 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2154 bp · LXL04_038573|LXL04_038573|OH1004|cDNA

ATGGCGTCAATATCACCGCCGACGTTCCGTTCCTCCGGCGGTAGCCCCGCTACGAGCCCTCACAAATTCACTTACGCAACCCCTAAGTTCGTCACAACCGGTCGACTGAACCACCGGTCCTCTTATTCAACGAGTCTATTCTCTCACTCTCTGTCTAGGGTTTCTGATTCTGCATCCATCTGCCGTTGCCAGAGTAATAGAGATATCGGTGAGAACAACGATAAAGACAAGGAAGGCTCTCGGCGATGGGACTCGGTTTT...

CDS

Download CDS FASTA

2154 bp · LXL04_038573|LXL04_038573|OH1004|CDS

ATGGCGTCAATATCACCGCCGACGTTCCGTTCCTCCGGCGGTAGCCCCGCTACGAGCCCTCACAAATTCACTTACGCAACCCCTAAGTTCGTCACAACCGGTCGACTGAACCACCGGTCCTCTTATTCAACGAGTCTATTCTCTCACTCTCTGTCTAGGGTTTCTGATTCTGCATCCATCTGCCGTTGCCAGAGTAATAGAGATATCGGTGAGAACAACGATAAAGACAAGGAAGGCTCTCGGCGATGGGACTCGGTTTT...

Protein

Download Protein FASTA

717 aa · LXL04_038573|LXL04_038573|OH1004|PROTEIN

MASISPPTFRSSGGSPATSPHKFTYATPKFVTTGRLNHRSSYSTSLFSHSLSRVSDSASICRCQSNRDIGENNDKDKEGSRRWDSVFQENVKNAIKWFEDYMTGYRKYQMNDDEAKKDDSVVKIEGEVVMDGDGDTDWDWERWQKHFTEVDEQERVVSILKSHLHRAIAKEDYEDAARIKVAIAASATNDTVGRVMSYLRKSIEEERYMDAAFVRDDASAGLVGWWAGLSDDSKDPYGRIIRISAEHGRYLARSYSPRQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038573`
TK1151 ID	TkA04G443100
OH-1004 ID	LXL04_038573
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038573

Location Chr09:44231469-44234637 (-)

Description Similar to EX1: Protein EXECUTER 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33630`	Together with EX2, enables higher plants to perceive singlet oxygen as a stress signal in plastid that activates a genetically determined nuclear stress response program which triggers a programmed cell death (PCD).	No verified direct reference in this release
`At1g27510`	Together with EX1, enables higher plants to perceive singlet oxygen as a stress signal in plastid that activates a genetically determined nuclear stress response program which triggers a programmed cell death (PCD).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0485300`	Together with EX2, enables higher plants to perceive singlet oxygen as a stress signal in plastid that activates a genetically determined nuclear stress response program which triggers a programmed cell death (PCD).	No verified direct reference in this release
`Os01g0107900`	Together with EX1, enables higher plants to perceive singlet oxygen as a stress signal in plastid that activates a genetically determined nuclear stress response program which triggers a programmed cell death (PCD).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038573 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000304 response to singlet oxygen Biological Process

GO:0010343 singlet oxygen-mediated programmed cell death Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0042651 thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT1G27510

ath:AT4G33630

dosa:Os01g0107900

dosa:Os10g0485300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.953

Rank 1 · LXL04_038573 · OH-1004

Nucleus0.057

Rank 2 · LXL04_038573 · OH-1004

Mitochondrion0.039

Rank 3 · LXL04_038573 · OH-1004

Cytoplasm0.035

Rank 4 · LXL04_038573 · OH-1004

Peroxisome0.020

Rank 5 · LXL04_038573 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12014.14Cyclin_D1_bind535-714 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038573	`PF12014.14`	Cyclin_D1_bind	535	714	4.4e-30	105.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YW0`	Arabidopsis thaliana	Protein EXECUTER 1, chloroplastic	47.855%	Swiss-Prot	moderate database homology
`Q94AT5`	Arabidopsis thaliana	Protein EXECUTER 2, chloroplastic	35.382%	Swiss-Prot	moderate database homology
`Q7XD99`	Oryza sativa subsp. japonica	Protein EXECUTER 1, chloroplastic	37.553%	Swiss-Prot	moderate database homology
`Q657X6`	Oryza sativa subsp. japonica	Protein EXECUTER 2, chloroplastic	37.013%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card