LXL04_037719 | RubberDandelionOmics

Gene overview

LXL04_037719

Reference: OH-1004 Chr: Chr09 Coordinates: 19376883-19381000 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1596 bp · LXL04_037719|LXL04_037719|OH1004|cDNA

ATGGCTAAATTCAGTTGCTGTTTTGGGGGCGTAGTTTCCCCACGTGGTGGTGGTGTTCATAGAGTAAACAATAGGGGAAGCAACACTGATATTAGTGTAGAACTTTTGGATATTAACAATATGCGATTGTACACATACAAAGATTTGCAAACTGCTACACAAGATTTTAATCCCGATACTAAGATAGGACAGGGAGGTTTCGGTTCCGTTTATAAGGGACTACTTAAAGATGGCAAATTAGTTGCTATAAAGGTGCTCTC...

CDS

Download CDS FASTA

1596 bp · LXL04_037719|LXL04_037719|OH1004|CDS

ATGGCTAAATTCAGTTGCTGTTTTGGGGGCGTAGTTTCCCCACGTGGTGGTGGTGTTCATAGAGTAAACAATAGGGGAAGCAACACTGATATTAGTGTAGAACTTTTGGATATTAACAATATGCGATTGTACACATACAAAGATTTGCAAACTGCTACACAAGATTTTAATCCCGATACTAAGATAGGACAGGGAGGTTTCGGTTCCGTTTATAAGGGACTACTTAAAGATGGCAAATTAGTTGCTATAAAGGTGCTCTC...

Protein

Download Protein FASTA

531 aa · LXL04_037719|LXL04_037719|OH1004|PROTEIN

MAKFSCCFGGVVSPRGGGVHRVNNRGSNTDISVELLDINNMRLYTYKDLQTATQDFNPDTKIGQGGFGSVYKGLLKDGKLVAIKVLSTESRQGLREFLTEITVISDIQHENLVKLHGYCVEKDHRILVYGYLKNGSLDRTLLDGEDCGIKFTWEIRRKICIGVAKGLAYLHEEVQPHVIHRDIKASNILLDEDFTPKISDFGLAKLFPSHLTHVSTRIAGTQGYLAPEYAIRGQLTRKADIYSFGVLLLEIVSGRPNQSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037719`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037719

Location Chr09:19376883-19381000 (-)

Description Similar to CRPK1: Cold-responsive protein kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16670`	Negative regulator of freezing tolerance that phosphorylates 14-3-3 proteins (e.g. GRF6) thus triggering their translocation from the cytosol to the nucleus in response to cold stress.	No verified direct reference in this release
`At1g56140`	Probable LRR receptor-like serine/threonine-protein kinase At1g56140.	No verified direct reference in this release
`At1g56130`	Probable LRR receptor-like serine/threonine-protein kinase At1g56130.	No verified direct reference in this release
`At3g14840`	Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840.	No verified direct reference in this release
`At1g53430`	Probable LRR receptor-like serine/threonine-protein kinase At1g53430.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037719 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0009409 response to cold Biological Process

GO:0009625 response to insect Biological Process

GO:0009861 jasmonic acid and ethylene-dependent systemic resistance Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050826 response to freezing Biological Process

GO:0052542 defense response by callose deposition Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G16670

ath:AT1G53430

ath:AT1G56130

ath:AT1G56140

ath:AT3G14840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.630

Rank 1 · LXL04_037719 · OH-1004

Cytoplasm0.219

Rank 2 · LXL04_037719 · OH-1004

Nucleus0.165

Rank 3 · LXL04_037719 · OH-1004

Endoplasmic reticulum0.076

Rank 4 · LXL04_037719 · OH-1004

Golgi apparatus0.048

Rank 5 · LXL04_037719 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase58-323 aa

PF07714.24PK_Tyr_Ser-Thr59-257 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037719	`PF00069.32`	Pkinase	58	323	2e-47	162.5
LXL04_037719	`PF07714.24`	PK_Tyr_Ser-Thr	59	257	4.2e-45	154.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YN1`	Arabidopsis thaliana	Cold-responsive protein kinase 1	64.048%	Swiss-Prot	moderate database homology
`C0LGH3`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g56140	50.949%	Swiss-Prot	moderate database homology
`C0LGH2`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g56130	51.974%	Swiss-Prot	moderate database homology
`C0LGN2`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840	49.835%	Swiss-Prot	moderate database homology
`C0LGG8`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g53430	54.930%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card