LXL04_036173 | RubberDandelionOmics

Gene overview

LXL04_036173

Reference: OH-1004 Chr: Chr08 Coordinates: 37516977-37520102 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1266 bp · LXL04_036173|LXL04_036173|OH1004|cDNA

ATGCCATCGTTTCCTCAGCCAGGCTCAGTTACTGTATGCGAAATCAACAGAGATCTAATTACCGCTGAAAGTTTTTCGGAGGATCAAGCAAAGGAAACTTATGGAAAAGTTCTTGGAGTAGTATTCGGTCCAATTTCGTACCAGTTGGAGTATCCACCGTCGCCACATCCCGATAGAGGCGTAGAACTGCCAGTGAATCGTTTATCGCGTTTACTTCAAGCAGTCTCTTATGGTCCGCTTAAAAGCCTTCTTGGTTCAGA...

CDS

Download CDS FASTA

1266 bp · LXL04_036173|LXL04_036173|OH1004|CDS

ATGCCATCGTTTCCTCAGCCAGGCTCAGTTACTGTATGCGAAATCAACAGAGATCTAATTACCGCTGAAAGTTTTTCGGAGGATCAAGCAAAGGAAACTTATGGAAAAGTTCTTGGAGTAGTATTCGGTCCAATTTCGTACCAGTTGGAGTATCCACCGTCGCCACATCCCGATAGAGGCGTAGAACTGCCAGTGAATCGTTTATCGCGTTTACTTCAAGCAGTCTCTTATGGTCCGCTTAAAAGCCTTCTTGGTTCAGA...

Protein

Download Protein FASTA

421 aa · LXL04_036173|LXL04_036173|OH1004|PROTEIN

MPSFPQPGSVTVCEINRDLITAESFSEDQAKETYGKVLGVVFGPISYQLEYPPSPHPDRGVELPVNRLSRLLQAVSYGPLKSLLGSDDVKLLQHVDLKCVGWHQKKDILAFISARNQVTIRDYGDSEGKEPCILMNDLQREAKLLEWRPNAGKTLSVGCKGGICIWAASYPGNTACVRPGVSSGSLSRGSGVKWTLVDFLRVHTSASYGSSSFTIWDAAQGVGTPLRRGFGSISLLKWSPTRDYFFSAKCDGTFYLWETN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036173`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036173

Location Chr08:37516977-37520102 (+)

Description Similar to AAAS: Aladin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56900`	Aladin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036173 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001578 microtubule bundle formation Biological Process

GO:0006749 glutathione metabolic process Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009566 fertilization Biological Process

GO:0015031 protein transport Biological Process

GO:0035264 multicellular organism growth Biological Process

GO:0046822 regulation of nucleocytoplasmic transport Biological Process

GO:0051028 mRNA transport Biological Process

GO:0090307 mitotic spindle assembly Biological Process

GO:1902365 positive regulation of protein localization to spindle pole body Biological Process

GO:0000922 spindle pole Cellular Component

KEGG gene cross-reference

ath:AT3G56900

dme:Dmel_CG16892

hsa:8086

mmu:223921

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.445

Rank 1 · LXL04_036173 · OH-1004

Nucleus0.309

Rank 2 · LXL04_036173 · OH-1004

Cell membrane0.144

Rank 3 · LXL04_036173 · OH-1004

Golgi apparatus0.131

Rank 4 · LXL04_036173 · OH-1004

Endoplasmic reticulum0.122

Rank 5 · LXL04_036173 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25460.2Beta-prop_Aladin94-413 aa

PF24817.2WD40_WDHD1_1st96-287 aa

PF25174.2Beta-prop_THOC3214-348 aa

PF23381.2Beta-prop_IFT122_1st214-291 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036173	`PF25460.2`	Beta-prop_Aladin	94	413	2.4e-47	162.4
LXL04_036173	`PF24817.2`	WD40_WDHD1_1st	96	287	3.1e-06	27.3
LXL04_036173	`PF25174.2`	Beta-prop_THOC3	214	348	2.3e-08	34.1
LXL04_036173	`PF23381.2`	Beta-prop_IFT122_1st	214	291	6.1e-08	33.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWR1`	Arabidopsis thaliana	Aladin	63.982%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card