LXL04_035922 | RubberDandelionOmics

Gene overview

LXL04_035922

Reference: OH-1004 Chr: Chr08 Coordinates: 32219148-32222150 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

528 bp · LXL04_035922|LXL04_035922|OH1004|cDNA

ATGCTACTCGCAGCTACACCTATTTCCTTTTATGCTCCACCAAAGCCTCTTTCACCTGTAATACGTTCTTCTCCCCTGAAAACAAGAGATTTTGCTTCTATATTCTCCACCACTACCCAATCCGTAACATCTTCAGTTCAGTCGCCGTCACGAAGGTTGCTTCCTACTCCACCTTCAGGAAAATTTCTCAGAGAAGACTACCTTGTTAAAAAGTTTTCTGCTAAAGAAATTCAGGATTTAGTAAGAGGAGAAAGAAACGT...

CDS

Download CDS FASTA

528 bp · LXL04_035922|LXL04_035922|OH1004|CDS

ATGCTACTCGCAGCTACACCTATTTCCTTTTATGCTCCACCAAAGCCTCTTTCACCTGTAATACGTTCTTCTCCCCTGAAAACAAGAGATTTTGCTTCTATATTCTCCACCACTACCCAATCCGTAACATCTTCAGTTCAGTCGCCGTCACGAAGGTTGCTTCCTACTCCACCTTCAGGAAAATTTCTCAGAGAAGACTACCTTGTTAAAAAGTTTTCTGCTAAAGAAATTCAGGATTTAGTAAGAGGAGAAAGAAACGT...

Protein

Download Protein FASTA

175 aa · LXL04_035922|LXL04_035922|OH1004|PROTEIN

MLLAATPISFYAPPKPLSPVIRSSPLKTRDFASIFSTTTQSVTSSVQSPSRRLLPTPPSGKFLREDYLVKKFSAKEIQDLVRGERNVPLIIDFYATWCGPCILMAQELEMLAVEYESNAMIVKVDTDDEYEFARDMQVRGLPTLYFISPDPTKDAIRTEGVIPIQMMRDIIDKDM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035922`
TK1151 ID	TkA04G096360
OH-1004 ID	LXL04_035922
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035922

Location Chr08:32219148-32222150 (-)

Description Similar to CITRX: Thioredoxin-like protein CITRX, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06730`	Thiol-disulfide oxidoreductase that plays a role in proper chloroplast development, most likely through regulating plastid-encoded polymerase (PEP) dependent chloroplast transcription.	Plastidial thioredoxin z interacts with two fructokinase-like proteins in a thiol-dependent manner: evidence for an essential role in chloroplast development in Arabidopsis and Nicotiana benthamiana.2010 · DOI: 10.1105/tpc.109.071001

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035922 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009657 plastid organization Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0042644 chloroplast nucleoid Cellular Component

GO:0015035 protein-disulfide reductase activity Molecular Function

GO:0015036 disulfide oxidoreductase activity Molecular Function

GO:0047134 protein-disulfide reductase [NAD(P)H] activity Molecular Function

KEGG gene cross-reference

ath:AT3G06730

sly:543657

sot:102585257

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.982

Rank 1 · LXL04_035922 · OH-1004

Mitochondrion0.024

Rank 2 · LXL04_035922 · OH-1004

Nucleus0.021

Rank 3 · LXL04_035922 · OH-1004

Cytoplasm0.017

Rank 4 · LXL04_035922 · OH-1004

Cell membrane0.011

Rank 5 · LXL04_035922 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085.27Thioredoxin74-161 aa

PF13098.14Thioredoxin_284-173 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035922	`PF00085.27`	Thioredoxin	74	161	8.8e-19	68.1
LXL04_035922	`PF13098.14`	Thioredoxin_2	84	173	2.6e-08	34.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M7X9`	Arabidopsis thaliana	Thioredoxin-like protein CITRX, chloroplastic	69.231%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card