LXL04_035329 | RubberDandelionOmics

Gene overview

LXL04_035329

Reference: OH-1004 Chr: Chr08 Coordinates: 20458874-20460257 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1137 bp · LXL04_035329|LXL04_035329|OH1004|cDNA

ATGCAGGTTTTAATTTCTATAAAAGAAAACATGAACAGTTTTTCACATGTACCTCCTGGTTTTCGGTTCCATCCCACTGATGAAGAACTTGTCGATTACTACCTTCGGAAAAAGATAAACTCAAGAAGGATTGACCTAGATGTCATCAGAGATATCGATCTTTACAAAATCGAGCCATGGGATCTTCAAGAGTTGTGCAGGCTAGGTACCGAAGAGCAAAGCGAATGGTATTTCTTTAGTCATAAAGATAAGAAATATCC...

CDS

Download CDS FASTA

1137 bp · LXL04_035329|LXL04_035329|OH1004|CDS

ATGCAGGTTTTAATTTCTATAAAAGAAAACATGAACAGTTTTTCACATGTACCTCCTGGTTTTCGGTTCCATCCCACTGATGAAGAACTTGTCGATTACTACCTTCGGAAAAAGATAAACTCAAGAAGGATTGACCTAGATGTCATCAGAGATATCGATCTTTACAAAATCGAGCCATGGGATCTTCAAGAGTTGTGCAGGCTAGGTACCGAAGAGCAAAGCGAATGGTATTTCTTTAGTCATAAAGATAAGAAATATCC...

Protein

Download Protein FASTA

378 aa · LXL04_035329|LXL04_035329|OH1004|PROTEIN

MQVLISIKENMNSFSHVPPGFRFHPTDEELVDYYLRKKINSRRIDLDVIRDIDLYKIEPWDLQELCRLGTEEQSEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIYSKQDLVGMRKTLVFYKGRAPNGQKSDWIMHEYRLETDENPTITQEEGWVVCRVFKKRLPTLRRASEHDHQSPIWYDDHQVSSFMPEIDSPNHNSQSHLQVNHNYQYPNYDSCKKELDQLQNYQITPDHFLQLPQLESPKLLPTCNSFVP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035329`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035329

Location Chr08:20458874-20460257 (+)

Description Similar to NAC007: NAC domain-containing protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12260`	Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity).	Arabidopsis NAC domain proteins, VND1 to VND5, are transcriptional regulators of secondary wall biosynthesis in vessels.2014 · DOI: 10.1371/journal.pone.0105726
`At1g62700`	Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity).	Arabidopsis NAC domain proteins, VND1 to VND5, are transcriptional regulators of secondary wall biosynthesis in vessels.2014 · DOI: 10.1371/journal.pone.0105726
`At2g18060`	Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity).	Arabidopsis NAC domain proteins, VND1 to VND5, are transcriptional regulators of secondary wall biosynthesis in vessels.2014 · DOI: 10.1371/journal.pone.0105726
`At4g36160`	Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity).	No verified direct reference in this release
`At5g62380`	Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', and to the tracheary elements (TE) specific regulating cis-element (TERE), 5'-CTTNAAAGCNA-3', in the promoter of target genes (e.g. genes involved in secondary wall biosynthesis, cell wall modification such as xylan accumulation, and programmed cell death).	Transcription switches for protoxylem and metaxylem vessel formation.2005 · DOI: 10.1101/gad.1331305 A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.2008 · DOI: 10.1105/tpc.108.061325 ASYMMETRIC LEAVES2-LIKE19/LATERAL ORGAN BOUNDARIES DOMAIN30 and ASL20/LBD18 regulate tracheary element differentiation in Arabidopsis.2008 · DOI: 10.1105/tpc.108.061796 MYB58 and MYB63 are transcriptional activators of the lignin biosynthetic pathway during secondary cell wall formation in Arabidopsis.2009 · DOI: 10.1105/tpc.108.063321 MYB83 is a direct target of SND1 and acts redundantly with MYB46 in the regulation of secondary cell wall biosynthesis in Arabidopsis.2009 · DOI: 10.1093/pcp/pcp139 VASCULAR-RELATED NAC-DOMAIN6 and VASCULAR-RELATED NAC-DOMAIN7 effectively induce transdifferentiation into xylem vessel elements under control of an induction system.2010 · DOI: 10.1104/pp.110.154013 Global analysis of direct targets of secondary wall NAC master switches in Arabidopsis.2010 · DOI: 10.1093/mp/ssq062 Arabidopsis VASCULAR-RELATED NAC-DOMAIN6 directly regulates the genes that govern programmed cell death and secondary wall formation during xylem differentiation.2010 · DOI: 10.1105/tpc.110.075036

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035329 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009620 response to fungus Biological Process

GO:0009733 response to auxin Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0010089 xylem development Biological Process

GO:0010981 regulation of cell wall macromolecule metabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0045491 xylan metabolic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT1G12260

ath:AT1G62700

ath:AT2G18060

ath:AT4G36160

ath:AT5G62380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.935

Rank 1 · LXL04_035329 · OH-1004

Cytoplasm0.155

Rank 2 · LXL04_035329 · OH-1004

Cell membrane0.038

Rank 3 · LXL04_035329 · OH-1004

Endoplasmic reticulum0.031

Rank 4 · LXL04_035329 · OH-1004

Plastid0.012

Rank 5 · LXL04_035329 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365.21NAM18-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035329	`PF02365.21`	NAM	18	145	1e-48	165.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FWX2`	Arabidopsis thaliana	NAC domain-containing protein 7	52.812%	Swiss-Prot	strong database homology
`F4HYV5`	Arabidopsis thaliana	NAC domain-containing protein 26	57.831%	Swiss-Prot	strong database homology
`Q9SL41`	Arabidopsis thaliana	NAC domain-containing protein 37	52.066%	Swiss-Prot	strong database homology
`O65508`	Arabidopsis thaliana	NAC domain-containing protein 76	51.437%	Swiss-Prot	strong database homology
`Q9LVA1`	Arabidopsis thaliana	NAC domain-containing protein 101	47.191%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card