LXL04_035097 | RubberDandelionOmics

Gene overview

LXL04_035097

Reference: OH-1004 Chr: Chr08 Coordinates: 14179785-14180834 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1050 bp · LXL04_035097|LXL04_035097|OH1004|cDNA

ATGGACGACTCTGCCACGAGTCACCATCCCCAAGACCATTTTACACACATCCACGACGACACCAATACTAACAATACTCACGTAGATCTCCATTCCCCTAattctccttctcttcctccCACCACCATAACATGCTCCGCCACCCTCGACAGTCCATCCTCTCATAAAAGAAAAGGGAAAGGGAAAGGAGGACCGGATAACAGCAAGTTTAAGTACAGAGGTGTTCGACAACGTAGCTGGGGCAAATGGGTCGCTGAGAT...

CDS

Download CDS FASTA

1050 bp · LXL04_035097|LXL04_035097|OH1004|CDS

ATGGACGACTCTGCCACGAGTCACCATCCCCAAGACCATTTTACACACATCCACGACGACACCAATACTAACAATACTCACGTAGATCTCCATTCCCCTAATTCTCCTTCTCTTCCTCCCACCACCATAACATGCTCCGCCACCCTCGACAGTCCATCCTCTCATAAAAGAAAAGGGAAAGGGAAAGGAGGACCGGATAACAGCAAGTTTAAGTACAGAGGTGTTCGACAACGTAGCTGGGGCAAATGGGTCGCTGAGAT...

Protein

Download Protein FASTA

349 aa · LXL04_035097|LXL04_035097|OH1004|PROTEIN

MDDSATSHHPQDHFTHIHDDTNTNNTHVDLHSPNSPSLPPTTITCSATLDSPSSHKRKGKGKGGPDNSKFKYRGVRQRSWGKWVAEIREPRKRTRRWLGTFSTAEDAARAYDRAAVILYGSGAQLNVLQPCSDGSSSATSSSSSFSRGGSGSSSSSTAQTLRPILPRPAGFNLTLSNSPSAVPVYGNYNYLPYGLVQYPLHVGKQLQEYFPYNSMDNINVARSADPTFRGIPSFTSHDPNPNPNPNLTLTLTPSSNRQRE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035097`
TK1151 ID	TkA04G168640
OH-1004 ID	LXL04_035097
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035097

Location Chr08:14179785-14180834 (+)

Description Similar to ABI4: Ethylene-responsive transcription factor ABI4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40220`	Transcription regulator that probably binds to the GCC-box pathogenesis-related promoter element.	Genetic analysis of salt-tolerant mutants in Arabidopsis thaliana.2000 · DOI: 10.1093/genetics/154.1.421 Analysis of Arabidopsis glucose insensitive mutants, gin5 and gin6, reveals a central role of the plant hormone ABA in the regulation of plant vegetative development by sugar.2000 · PMID: 10950871 The Arabidopsis SUCROSE UNCOUPLED-6 gene is identical to ABSCISIC ACID INSENSITIVE-4: involvement of abscisic acid in sugar responses.2000 · DOI: 10.1046/j.1365-313x.2000.00822.x The Arabidopsis sugar-insensitive mutants sis4 and sis5 are defective in abscisic acid synthesis and response.2000 · DOI: 10.1046/j.1365-313x.2000.00833.x Regulation and function of the Arabidopsis ABA-insensitive4 gene in seed and abscisic acid response signaling networks.2000 · DOI: 10.1104/pp.124.4.1752 Plastid redox state and sugars: interactive regulators of nuclear-encoded photosynthetic gene expression.2001 · DOI: 10.1073/pnas.98.4.2047 ABA plays a central role in mediating the regulatory effects of nitrate on root branching in Arabidopsis.2001 · DOI: 10.1046/j.1365-313x.2001.01185.x Mobilization of seed storage lipid by Arabidopsis seedlings is retarded in the presence of exogenous sugars.2002 · DOI: 10.1186/1471-2229-2-4 A screen for genes that function in abscisic acid signaling in Arabidopsis thaliana.2002 · DOI: 10.1093/genetics/161.3.1247 Regulatory networks in seeds integrating developmental, abscisic acid, sugar, and light signaling.2003 · DOI: 10.1104/pp.011916 Mechanisms of glucose signaling during germination of Arabidopsis.2003 · DOI: 10.1104/pp.103.020347 Beta-amino-butyric acid-induced resistance against necrotrophic pathogens is based on ABA-dependent priming for callose.2004 · DOI: 10.1111/j.1365-313x.2004.02028.x Interactions of abscisic acid and sugar signalling in the regulation of leaf senescence.2004 · DOI: 10.1007/s00425-004-1279-5 Oxalate production by Sclerotinia sclerotiorum deregulates guard cells during infection.2004 · DOI: 10.1104/pp.104.049650 Sugar and ABA responsiveness of a minimal RBCS light-responsive unit is mediated by direct binding of ABI4.2005 · DOI: 10.1111/j.1365-313x.2005.02468.x Role of abscisic acid (ABA) and Arabidopsis thaliana ABA-insensitive loci in low water potential-induced ABA and proline accumulation.2006 · DOI: 10.1093/jxb/erj026 Arabidopsis ABA INSENSITIVE4 regulates lipid mobilization in the embryo and reveals repression of seed germination by the endosperm.2006 · DOI: 10.1105/tpc.106.041277 ABI4 mediates the effects of exogenous trehalose on Arabidopsis growth and starch breakdown.2007 · DOI: 10.1007/s11103-006-9082-2 Sucrose control of phytochrome A signaling in Arabidopsis.1997 · DOI: 10.1105/tpc.9.4.583 An Arabidopsis mutant showing reduced feedback inhibition of photosynthesis.1997 · DOI: 10.1046/j.1365-313x.1997.12051011.x The Arabidopsis abscisic acid response locus ABI4 encodes an APETALA 2 domain protein.1998 · DOI: 10.1105/tpc.10.6.1043
`At3g57600`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'.	No verified direct reference in this release
`At5g18450`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0565200`	Probable transcriptional activator that binds to the DNA sequence 5'-[AG]CCGAC-3' of the cis-acting dehydration-responsive element (DRE).	No verified direct reference in this release
`Os05g0351200`	Probable transcription regulator that binds to cis-responsive elements of genes involved in stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035097 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005983 starch catabolic process Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006950 response to stress Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009749 response to glucose Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010119 regulation of stomatal movement Biological Process

KEGG gene cross-reference

ath:AT2G40220

ath:AT3G57600

ath:AT5G18450

dosa:Os05g0351200

dosa:Os08g0565200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.962

Rank 1 · LXL04_035097 · OH-1004

Cytoplasm0.097

Rank 2 · LXL04_035097 · OH-1004

Cell membrane0.035

Rank 3 · LXL04_035097 · OH-1004

Endoplasmic reticulum0.034

Rank 4 · LXL04_035097 · OH-1004

Plastid0.018

Rank 5 · LXL04_035097 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP271-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035097	`PF00847.27`	AP2	71	115	2e-12	48.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0MES8`	Arabidopsis thaliana	Ethylene-responsive transcription factor ABI4	45.667%	Swiss-Prot	moderate database homology
`Q9SVX5`	Arabidopsis thaliana	Dehydration-responsive element-binding protein 2F	62.651%	Swiss-Prot	weak database homology
`P61827`	Arabidopsis thaliana	Dehydration-responsive element-binding protein 2G	57.143%	Swiss-Prot	weak database homology
`Q84ZA1`	Oryza sativa subsp. japonica	Dehydration-responsive element-binding protein 2C	65.385%	Swiss-Prot	weak database homology
`C7J2Z1`	Oryza sativa subsp. japonica	Ethylene-responsive transcription factor ABI4	80.282%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card