LXL04_033648 | RubberDandelionOmics

Gene overview

LXL04_033648

Reference: OH-1004 Chr: Chr07 Coordinates: 51582053-51583414 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1362 bp · LXL04_033648|LXL04_033648|OH1004|cDNA

ATGCTTCAAGTCAAACACCAACTTTTCACTCAAAAAGTCATGGCATTTCCCCCATTCCTACTTGTAATAACACTAGCCACTCTATATACGGCCGGTTTTTCTCCGGCAACAGCCTCCCGAGTCGAATCCGGTGGTACATTTAGCATTGATCTTATCCATCGTGATTCCATAAAATCCCCCTTTTACGATGGTTCCATGACCTTTTCACAACGCCTTGTCCACGCTTTGCAACGTTCTTTTATCAATGCTAAACGTTACAA...

CDS

Download CDS FASTA

1362 bp · LXL04_033648|LXL04_033648|OH1004|CDS

ATGCTTCAAGTCAAACACCAACTTTTCACTCAAAAAGTCATGGCATTTCCCCCATTCCTACTTGTAATAACACTAGCCACTCTATATACGGCCGGTTTTTCTCCGGCAACAGCCTCCCGAGTCGAATCCGGTGGTACATTTAGCATTGATCTTATCCATCGTGATTCCATAAAATCCCCCTTTTACGATGGTTCCATGACCTTTTCACAACGCCTTGTCCACGCTTTGCAACGTTCTTTTATCAATGCTAAACGTTACAA...

Protein

Download Protein FASTA

453 aa · LXL04_033648|LXL04_033648|OH1004|PROTEIN

MLQVKHQLFTQKVMAFPPFLLVITLATLYTAGFSPATASRVESGGTFSIDLIHRDSIKSPFYDGSMTFSQRLVHALQRSFINAKRYKANGHLNGSTYQTRIMPDHGEFLVNLSFGNPSHNVMAIADTGSDLAWIQCKPCIKCYKHKGPLFDPKKSSTYRPIGCKSPTCMSIDTVDTSCSSTKTCEFYESYADGSFSNGSVSTETIGIGDRVLPDMVFGCGFSNDGVFRPTWGGIIGLGGGKVSLVSQILSFVPRRFSYCL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033648`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033648

Location Chr07:51582053-51583414 (-)

Description Similar to CDR1: Aspartic proteinase CDR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g33340`	Involved in salicylic acid-dependent inducible resistance responses.	An extracellular aspartic protease functions in Arabidopsis disease resistance signaling.2004 · DOI: 10.1038/sj.emboj.7600086
`At2g35615`	Probable aspartic protease At2g35615.	No verified direct reference in this release
`At1g01300`	Aspartyl protease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033648 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010310 regulation of hydrogen peroxide metabolic process Biological Process

GO:0010337 regulation of salicylic acid metabolic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01300

ath:AT2G35615

ath:AT5G33340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.547

Rank 1 · LXL04_033648 · OH-1004

Cell membrane0.163

Rank 2 · LXL04_033648 · OH-1004

Endoplasmic reticulum0.122

Rank 3 · LXL04_033648 · OH-1004

Cytoplasm0.092

Rank 4 · LXL04_033648 · OH-1004

Lysosome / Vacuole0.087

Rank 5 · LXL04_033648 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543.12TAXi_N108-280 aa

PF00026.29Asp108-159 aa

PF00026.29Asp163-445 aa

PF14541.12TAXi_C301-446 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033648	`PF14543.12`	TAXi_N	108	280	3.8e-44	151.7
LXL04_033648	`PF00026.29`	Asp	108	159	1.4e-23	84.5
LXL04_033648	`PF00026.29`	Asp	163	445	1.4e-23	84.5
LXL04_033648	`PF14541.12`	TAXi_C	301	446	8.8e-30	104.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6XBF8`	Arabidopsis thaliana	Aspartic proteinase CDR1	42.892%	Swiss-Prot	moderate database homology
`Q3EBM5`	Arabidopsis thaliana	Probable aspartic protease At2g35615	42.143%	Swiss-Prot	moderate database homology
`Q9LNJ3`	Arabidopsis thaliana	Aspartyl protease family protein 2	35.278%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card