LXL04_033593 | RubberDandelionOmics

Gene overview

LXL04_033593

Reference: OH-1004 Chr: Chr07 Coordinates: 48610492-48614682 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2169 bp · LXL04_033593|LXL04_033593|OH1004|cDNA

ATGATGGTGGTGGTTGACAGATGCAAGAACCTCAGAGAAAGACTTACAAGAATAAGGATGATGCATGGTGGTGGATACGTCGTGATGAATGTGCGAGTCCATCTTCATCCTCGCAATCGAACCTCTAGTGACAACTCCTCCTATCGGAATCCCTCTCACACTTTCTCGTCCTGTCGCATCTATTTCTCTCTGTTCAACGACTTTATTTCTCTTTCACGAAACATCTCGCACAATCCAGATGGTGGCGATGAATTACAAGT...

CDS

Download CDS FASTA

2169 bp · LXL04_033593|LXL04_033593|OH1004|CDS

ATGATGGTGGTGGTTGACAGATGCAAGAACCTCAGAGAAAGACTTACAAGAATAAGGATGATGCATGGTGGTGGATACGTCGTGATGAATGTGCGAGTCCATCTTCATCCTCGCAATCGAACCTCTAGTGACAACTCCTCCTATCGGAATCCCTCTCACACTTTCTCGTCCTGTCGCATCTATTTCTCTCTGTTCAACGACTTTATTTCTCTTTCACGAAACATCTCGCACAATCCAGATGGTGGCGATGAATTACAAGT...

Protein

Download Protein FASTA

722 aa · LXL04_033593|LXL04_033593|OH1004|PROTEIN

MMVVVDRCKNLRERLTRIRMMHGGGYVVMNVRVHLHPRNRTSSDNSSYRNPSHTFSSCRIYFSLFNDFISLSRNISHNPDGGDELQVPFLGFDVEKMISTTPPLIVIVDIIQSTTFFWLKYRSSMRFLFRISKTIMIIFQIVSATTHDLNDFSTTANPNNNIKHESEIVSFDFPYPPSYPEGGDFGKGVINLGGLEVYKAVYFKKIWSTNTGGPNNQGASFYEPTFLPYGFNLLGHYCKPNSRDFFAAVLTVKDATHDPY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033593`
TK1151 ID	TkA08G278100
OH-1004 ID	LXL04_033593
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	91.300
Protein coverage (%)	TK1151 90.801 / OH-1004 46.260 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033593

Location Chr07:48610492-48614682 (-)

Description Similar to TDA6: Putative vacuolar protein sorting-associated protein TDA6 (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04090`	Hypothetical protein At1g04090.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033593 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015031 protein transport Biological Process

GO:0016020 membrane Cellular Component

GO:0071944 cell periphery Cellular Component

KEGG gene cross-reference

ath:AT1G04090

sce:YPR157W

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.230

Rank 1 · LXL04_033593 · OH-1004

Lysosome / Vacuole0.217

Rank 2 · LXL04_033593 · OH-1004

Cytoplasm0.180

Rank 3 · LXL04_033593 · OH-1004

Cell membrane0.161

Rank 4 · LXL04_033593 · OH-1004

Golgi apparatus0.156

Rank 5 · LXL04_033593 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06101.17Vps62170-587 aa

PF06101.17Vps62613-720 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033593	`PF06101.17`	Vps62	170	587	1.8e-180	601.7
LXL04_033593	`PF06101.17`	Vps62	613	720	1.8e-180	601.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q501D1`	Arabidopsis thaliana	Hypothetical protein At1g04090	39.860%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card