LXL04_033504 | RubberDandelionOmics

Gene overview

LXL04_033504

Reference: OH-1004 Chr: Chr07 Coordinates: 45813863-45821178 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5976 bp · LXL04_033504|LXL04_033504|OH1004|cDNA

ATGCTCTGTGACTGCCGTGCAAACGGATCTCTCACATCAGAAAACTTATCTACTATATTCAACGTTACCACTAGCCGATCCATTGTTAAGATATCTTGTTGTTTTTCTATCAAACAATCGTCTGCTTCAAAGATAGATCAGTTATATGAAATAGCTTATCTTTCCGACGAATCAAAAATTCCCATATCCCAACTACCCATAGTAAATCCTTATAATGTTTGTAATAAACCCGTTACTTCATTCTCCAGAAAAGTCAAAAA...

CDS

Download CDS FASTA

5976 bp · LXL04_033504|LXL04_033504|OH1004|CDS

ATGCTCTGTGACTGCCGTGCAAACGGATCTCTCACATCAGAAAACTTATCTACTATATTCAACGTTACCACTAGCCGATCCATTGTTAAGATATCTTGTTGTTTTTCTATCAAACAATCGTCTGCTTCAAAGATAGATCAGTTATATGAAATAGCTTATCTTTCCGACGAATCAAAAATTCCCATATCCCAACTACCCATAGTAAATCCTTATAATGTTTGTAATAAACCCGTTACTTCATTCTCCAGAAAAGTCAAAAA...

Protein

Download Protein FASTA

1991 aa · LXL04_033504|LXL04_033504|OH1004|PROTEIN

MLCDCRANGSLTSENLSTIFNVTTSRSIVKISCCFSIKQSSASKIDQLYEIAYLSDESKIPISQLPIVNPYNVCNKPVTSFSRKVKKLIGSTSNQQAKEYVQTSKFDSFQLPSTSSEHLVTLSLPPDLPRSCLHQGYTHIHFGAVRLALPFHGRKGLPAYSRIALVDTRFVEYQHACIGTIQTTLNAGTIFVTFYPNFNMPLNDPSLFTALKARYQATFHYQMAYRVQNHSLDIMVPGQANSGDALFLDVDSNATPTCTY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033504`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_033504`
Location	Chr07:45813863-45821178 (-)
Description	Similar to Genome polyprotein (Petunia vein clearing virus (isolate Shepherd)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033504` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0046740 transport of virus in host, cell to cell Biological Process GO:0003677 DNA binding Molecular Function GO:0003887 DNA-directed DNA polymerase activity Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	vg:921337 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.564

Rank 1 · LXL04_033504 · OH-1004

Nucleus0.420

Rank 2 · LXL04_033504 · OH-1004

Mitochondrion0.130

Rank 3 · LXL04_033504 · OH-1004

Cell membrane0.053

Rank 4 · LXL04_033504 · OH-1004

Endoplasmic reticulum0.051

Rank 5 · LXL04_033504 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01107.24MP73-215 aa

PF28884.1Gen_polyprot_petuvir745-823 aa

PF00098.29zf-CCHC1012-1027 aa

PF17919.8RT_RNaseH_21452-1551 aa

PF17917.8RT_RNaseH1480-1583 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033504	`PF01107.24`	MP	73	215	6.9e-06	26.5
LXL04_033504	`PF28884.1`	Gen_polyprot_petuvir	745	823	1.2e-25	90.2
LXL04_033504	`PF00098.29`	zf-CCHC	1012	1027	2.8e-06	27.9
LXL04_033504	`PF17919.8`	RT_RNaseH_2	1452	1551	7.9e-20	71.5
LXL04_033504	`PF17917.8`	RT_RNaseH	1480	1583	3.9e-18	66.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card