LXL04_033480 | RubberDandelionOmics

Gene overview

LXL04_033480

Reference: OH-1004 Chr: Chr07 Coordinates: 45043019-45044964 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1698 bp · LXL04_033480|LXL04_033480|OH1004|cDNA

ATGCAGAGGTCACGTAAAGCTCTTCTTTCAAGAAGAGCTTCTTTGGAAAAACCTACTTTTGGGAAAAACAATCTTTACAAGGTTTCACTATCTCTTGCTGTCTTTCTTTGGGGGCTTTTGTTCCTTTTAAATTTATGGATCGGTCATGGTGATGGTTATAGAGATGGTACAGAAGATCTTCCAAATGGTTTACAAACATGGGACGAATTCAACCATGAATCCAATAACTCATCTTACTGCTCATCATCATCAAACGAATG...

CDS

Download CDS FASTA

1698 bp · LXL04_033480|LXL04_033480|OH1004|CDS

ATGCAGAGGTCACGTAAAGCTCTTCTTTCAAGAAGAGCTTCTTTGGAAAAACCTACTTTTGGGAAAAACAATCTTTACAAGGTTTCACTATCTCTTGCTGTCTTTCTTTGGGGGCTTTTGTTCCTTTTAAATTTATGGATCGGTCATGGTGATGGTTATAGAGATGGTACAGAAGATCTTCCAAATGGTTTACAAACATGGGACGAATTCAACCATGAATCCAATAACTCATCTTACTGCTCATCATCATCAAACGAATG...

Protein

Download Protein FASTA

565 aa · LXL04_033480|LXL04_033480|OH1004|PROTEIN

MQRSRKALLSRRASLEKPTFGKNNLYKVSLSLAVFLWGLLFLLNLWIGHGDGYRDGTEDLPNGLQTWDEFNHESNNSSYCSSSSNECPTLDSQTLIETDQKDEIPIPIGQEFEVDQKDQNPQPKSQSKSEKSRSVPLGLDEFKNRAFNTKTKPSNGNSNSNSYSNSNSVTIIHRLEPGGADYNYASASKGAKVLSWNKEAKGASNILTIDKDKYLRNPCSSEEKFVVLELSEETLVDTIKIANFEHHSSNLKEFEILGSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033480`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033480

Location Chr07:45043019-45044964 (+)

Description Similar to SUN4: SUN domain-containing protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71360`	Encodes a member of the mid-SUN subfamily of SUN-domain proteins that is localized to both the nuclear envelope and the ER.	No verified direct reference in this release
`At1g22882`	Encodes a member of the mid-SUN subfamily of SUN-domain proteins that is localized to both the nuclear envelope and the ER.	No verified direct reference in this release
`At4g23950`	Encodes a member of the mid-SUN subfamily of SUN-domain proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033480 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0006997 nucleus organization Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0034975 protein folding in endoplasmic reticulum Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT1G22882

ath:AT1G71360

ath:AT4G23950

ddi:DDB_G0285925

spo:2540275

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.591

Rank 1 · LXL04_033480 · OH-1004

Golgi apparatus0.378

Rank 2 · LXL04_033480 · OH-1004

Nucleus0.081

Rank 3 · LXL04_033480 · OH-1004

Cytoplasm0.073

Rank 4 · LXL04_033480 · OH-1004

Cell membrane0.055

Rank 5 · LXL04_033480 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07738.20Sad1_UNC197-319 aa

PF06588.18Muskelin_N220-340 aa

PF00754.32F5_F8_type_C220-304 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033480	`PF07738.20`	Sad1_UNC	197	319	1.6e-31	109.8
LXL04_033480	`PF06588.18`	Muskelin_N	220	340	6.7e-08	33.4
LXL04_033480	`PF00754.32`	F5_F8_type_C	220	304	6.7e-06	27.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I8I0`	Arabidopsis thaliana	SUN domain-containing protein 4	43.046%	Swiss-Prot	moderate database homology
`F4I316`	Arabidopsis thaliana	SUN domain-containing protein 3	44.590%	Swiss-Prot	moderate database homology
`F4JPE9`	Arabidopsis thaliana	SUN domain-containing protein 5	42.716%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card