LXL04_031859 | RubberDandelionOmics

Gene overview

LXL04_031859

Reference: OH-1004 Chr: Chr07 Coordinates: 12272018-12288692 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

9141 bp · LXL04_031859|LXL04_031859|OH1004|cDNA

ATGGTCACGTCTGCAGATGTTCATGAAATCGTTTTGAAGCTCTCATCTGATAAGGCCAAAGCCCGTGAAGTAATGTTCCTACCGGAAGGGATTAAATTGTTGAATACATGGCTAGAAGGAGAAAGGTTGATCGAATTTTGTAGATATATAGGACGCAATACATCCATGCTCAAACCTCATGAGGTACCACATGGTAAGACGAATCCATGTATTGTGAACTTAAGTGATAACCTGCTAACTGAAACTTGGCCTTTTCTTGT...

CDS

Download CDS FASTA

9141 bp · LXL04_031859|LXL04_031859|OH1004|CDS

ATGGTCACGTCTGCAGATGTTCATGAAATCGTTTTGAAGCTCTCATCTGATAAGGCCAAAGCCCGTGAAGTAATGTTCCTACCGGAAGGGATTAAATTGTTGAATACATGGCTAGAAGGAGAAAGGTTGATCGAATTTTGTAGATATATAGGACGCAATACATCCATGCTCAAACCTCATGAGGTACCACATGGTAAGACGAATCCATGTATTGTGAACTTAAGTGATAACCTGCTAACTGAAACTTGGCCTTTTCTTGT...

Protein

Download Protein FASTA

3046 aa · LXL04_031859|LXL04_031859|OH1004|PROTEIN

MVTSADVHEIVLKLSSDKAKAREVMFLPEGIKLLNTWLEGERLIEFCRYIGRNTSMLKPHEVPHGKTNPCIVNLSDNLLTETWPFLVKLLTEAIKLEVSASKKRLPKLAFAKTLRIVVQRAEDGKSLHLLSVAKLLYNHIWKILNDVPSFQSEYGIILRHLLAVKQLQFHLRKSVYSSLVLFYMGKVEISLSEHITGQSIKEEVFRCILTLNSLLDSPPADFPDDLREGITKGFIDIFSNLRDEGKIVRNLVGCINTYLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031859`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031859

Location Chr07:12272018-12288692 (-)

Description Similar to ATM: Serine/threonine-protein kinase ATM

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48190`	Serine/threonine protein kinase which activates checkpoint signaling upon genotoxic stresses such as ionizing radiation (IR) or DNA replication stalling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031859 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000077 DNA damage checkpoint signaling Biological Process

GO:0000425 pexophagy Biological Process

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0000729 DNA double-strand break processing Biological Process

GO:0001666 response to hypoxia Biological Process

GO:0002376 immune system process Biological Process

GO:0006281 DNA repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006325 chromatin organization Biological Process

KEGG gene cross-reference

afm:AFUA_5G12660

hsa:472

mmu:11920

ssc:100101922

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.540

Rank 1 · LXL04_031859 · OH-1004

Cytoplasm0.316

Rank 2 · LXL04_031859 · OH-1004

Golgi apparatus0.101

Rank 3 · LXL04_031859 · OH-1004

Endoplasmic reticulum0.080

Rank 4 · LXL04_031859 · OH-1004

Cell membrane0.076

Rank 5 · LXL04_031859 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25360.2TPR_ATM1215-1411 aa

PF00454.34PI3_PI4_kinase2721-2962 aa

PF02260.26FATC3017-3046 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031859	`PF25360.2`	TPR_ATM	1215	1411	1.1e-92	309.7
LXL04_031859	`PF00454.34`	PI3_PI4_kinase	2721	2962	2.2e-53	182.4
LXL04_031859	`PF02260.26`	FATC	3017	3046	4.2e-13	49.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M3G7`	Arabidopsis thaliana	Serine/threonine-protein kinase ATM	54.972%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card