LXL04_030089 | RubberDandelionOmics

Gene overview

LXL04_030089

Reference: OH-1004 Chr: Chr06 Coordinates: 107243541-107245089 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1335 bp · LXL04_030089|LXL04_030089|OH1004|cDNA

ATGTCAAGTTTTCAAACTGATCAGTTTTTTAGTAGTCGTGAAAATGTAGAGGATTGGGTGCGAAATGTAGGACGGAATCTCGGGTATGTGGTTGTTACTAGAAGAACAAAGCAAAAAAATGGCTATTTGTCTAGATTTATTTTTATGTGTGATCGGGGTGGTGTGTTTAAAGGTCAGGAGACGTCCTCCAGAAATACTGGAACAAGAAAAATAGATTGTCCATTCGAATTGCATGCTTGTTACTATAAGTCAAATGATGT...

CDS

Download CDS FASTA

1335 bp · LXL04_030089|LXL04_030089|OH1004|CDS

ATGTCAAGTTTTCAAACTGATCAGTTTTTTAGTAGTCGTGAAAATGTAGAGGATTGGGTGCGAAATGTAGGACGGAATCTCGGGTATGTGGTTGTTACTAGAAGAACAAAGCAAAAAAATGGCTATTTGTCTAGATTTATTTTTATGTGTGATCGGGGTGGTGTGTTTAAAGGTCAGGAGACGTCCTCCAGAAATACTGGAACAAGAAAAATAGATTGTCCATTCGAATTGCATGCTTGTTACTATAAGTCAAATGATGT...

Protein

Download Protein FASTA

444 aa · LXL04_030089|LXL04_030089|OH1004|PROTEIN

MSSFQTDQFFSSRENVEDWVRNVGRNLGYVVVTRRTKQKNGYLSRFIFMCDRGGVFKGQETSSRNTGTRKIDCPFELHACYYKSNDVWMLKFKNDQHNHEPAMFLEGHPFARRLTPKEVEMVAEMRRNNVPPWKILEVLKSHNENNVSTIKTIYNESNKIRIDERAGRSQMQVVFGFLHSKKYIFEYHKNDTTNALEDIFFVHPTSLVICRAFPQIMMMDATYKTNKYKMPFLEIVGVTSTNTTFCIGFGFINEEKESNY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030089`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030089

Location Chr06:107243541-107245089 (-)

Description Similar to CHGG_01239: PKS-NRPS hybrid synthetase CHGG_01239 (Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38180`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At2g32250`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At1g52520`	Putative transcription activator involved in regulating light control of development.	Arabidopsis FHY3/FAR1 gene family and distinct roles of its members in light control of Arabidopsis development.2004 · DOI: 10.1104/pp.104.052191
`At2g27110`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030089 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009403 toxin biosynthetic process Biological Process

GO:0032259 methylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0004312 fatty acid synthase activity Molecular Function

GO:0004315 3-oxoacyl-[acyl-carrier-protein] synthase activity Molecular Function

GO:0008168 methyltransferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0016853 isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G52520

ath:AT2G27110

ath:AT2G32250

ath:AT4G38180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.922

Rank 1 · LXL04_030089 · OH-1004

Cytoplasm0.150

Rank 2 · LXL04_030089 · OH-1004

Cell membrane0.016

Rank 3 · LXL04_030089 · OH-1004

Mitochondrion0.014

Rank 4 · LXL04_030089 · OH-1004

Endoplasmic reticulum0.011

Rank 5 · LXL04_030089 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08731.18AFT10-100 aa

PF21056.4ZSWIM1-3_RNaseH-like189-300 aa

PF10551.16MULE217-311 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030089	`PF08731.18`	AFT	10	100	7.5e-06	26.9
LXL04_030089	`PF21056.4`	ZSWIM1-3_RNaseH-like	189	300	3.3e-12	47.2
LXL04_030089	`PF10551.16`	MULE	217	311	2.4e-26	92.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZL8`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 5	19.108%	Swiss-Prot	weak database homology
`Q3EBQ3`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 2	20.521%	Swiss-Prot	weak database homology
`Q9SSQ4`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 6	25.926%	Swiss-Prot	weak database homology
`Q9ZVC9`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 3	24.576%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card