LXL04_029750 | RubberDandelionOmics

Gene overview

LXL04_029750

Reference: OH-1004 Chr: Chr06 Coordinates: 99081329-99086982 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1819 bp · LXL04_029750|LXL04_029750|OH1004|cDNA

GCCAATTGTTTAAGAGGTCAGCCACTGCCACAAGCAGCATGGATAGCATTATAGCAAGCTCACTCAATCCGCGCACCAAATGGCTACGGCGGCGTTGTCGCCGGCCACGGTGGTTTGTCTCCGACTTAAACCTCTCTCTTCCACCGTTCGCTTCCTGTCCTTGTACCGCCACCACCAACCAAAACCTAcgaaagtgaaataccaaaTCAGCATCGCTCCTCTTCATCACCCGCCACAACCCCGCGTCCACTTTAACTACT...

CDS

Download CDS FASTA

1740 bp · LXL04_029750|LXL04_029750|OH1004|CDS

ATGGCTACGGCGGCGTTGTCGCCGGCCACGGTGGTTTGTCTCCGACTTAAACCTCTCTCTTCCACCGTTCGCTTCCTGTCCTTGTACCGCCACCACCAACCAAAACCTACGAAAGTGAAATACCAAATCAGCATCGCTCCTCTTCATCACCCGCCACAACCCCGCGTCCACTTTAACTACTTAAACAACTCCACAACTAACCATCGATGCTTTTCAACCGTCGTATCCGCCACTGTATCACCCGGAGAGGTCTCAGAGAA...

Protein

Download Protein FASTA

579 aa · LXL04_029750|LXL04_029750|OH1004|PROTEIN

MATAALSPATVVCLRLKPLSSTVRFLSLYRHHQPKPTKVKYQISIAPLHHPPQPRVHFNYLNNSTTNHRCFSTVVSATVSPGEVSEKSNTESIGERVGEFRKRLTIVDIKGGESEGVDRLGQTLTVKGWVRTVRIQSSVTFIEVNDGSCVSNMQCVIGPDAKGYDQVESGSITTGASVCVQGVVVPSQGKKQKIELKIDKLVLVGKSPSSFPIQKKKVTREFLRGEAHLRVRTNTFGAVSRVRSALYQATHKFFQENGFV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029750`
TK1151 ID	TkA07G343450
OH-1004 ID	LXL04_029750
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029750

Location Chr06:99081329-99086982 (+)

Description Similar to SYNO: Asparagine--tRNA ligase, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17300`	Asparagine--tRNA ligase, chloroplastic/mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029750 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006421 asparaginyl-tRNA aminoacylation Biological Process

GO:0048481 plant ovule development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0004816 asparagine-tRNA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016740 transferase activity Molecular Function

GO:0140096 catalytic activity, acting on a protein Molecular Function

KEGG gene cross-reference

ana:alr3658

ath:AT4G17300

cbf:CLI_0677

mar:MAE_04410

pcu:PC_RS01700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.892

Rank 1 · LXL04_029750 · OH-1004

Mitochondrion0.173

Rank 2 · LXL04_029750 · OH-1004

Cytoplasm0.032

Rank 3 · LXL04_029750 · OH-1004

Nucleus0.022

Rank 4 · LXL04_029750 · OH-1004

Peroxisome0.013

Rank 5 · LXL04_029750 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01336.32tRNA_anti-codon125-203 aa

PF00152.26tRNA-synt_2226-572 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029750	`PF01336.32`	tRNA_anti-codon	125	203	5.8e-10	39.7
LXL04_029750	`PF00152.26`	tRNA-synt_2	226	572	3.1e-63	214.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48593`	Arabidopsis thaliana	Asparagine--tRNA ligase, chloroplastic/mitochondrial	70.294%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card