LXL04_029177 | RubberDandelionOmics

Gene overview

LXL04_029177

Reference: OH-1004 Chr: Chr06 Coordinates: 82534677-82539924 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2454 bp · LXL04_029177|LXL04_029177|OH1004|cDNA

ATGATTGAAGACTTTCCGTATCCAAACCTCAAAGGAAAGTTGGCTCCCCAACGCCGAATACAGCGCCACATGGGCGGCCAGATGCAACAGAGAAATGCTTCGGCAACTTCTCTGTATGATCAACCTGCAGATGGTGCATCACATCACAATGCAGGTTCAGCTAATGATGCTGGAGATGCTGTGATGGCAAGATGGCTCCAGTCTGCAGGTCTACAGCATTTGGCCTCACCCGTGGCATCAAATGGAGTTGATCAACGCCA...

CDS

Download CDS FASTA

2454 bp · LXL04_029177|LXL04_029177|OH1004|CDS

ATGATTGAAGACTTTCCGTATCCAAACCTCAAAGGAAAGTTGGCTCCCCAACGCCGAATACAGCGCCACATGGGCGGCCAGATGCAACAGAGAAATGCTTCGGCAACTTCTCTGTATGATCAACCTGCAGATGGTGCATCACATCACAATGCAGGTTCAGCTAATGATGCTGGAGATGCTGTGATGGCAAGATGGCTCCAGTCTGCAGGTCTACAGCATTTGGCCTCACCCGTGGCATCAAATGGAGTTGATCAACGCCA...

Protein

Download Protein FASTA

817 aa · LXL04_029177|LXL04_029177|OH1004|PROTEIN

MIEDFPYPNLKGKLAPQRRIQRHMGGQMQQRNASATSLYDQPADGASHHNAGSANDAGDAVMARWLQSAGLQHLASPVASNGVDQRHLPNLLMQGYGAQSAEEKQRLFKLMRNLNFNGESGSEPFSPTTQGSVGIGASEGFYSPDFRGDFGAGLLDLHAMDDTELLTENVDSEPFEQSPFLPVVTNNDQDVPPYRQQRGQPDVDASYGLPTLEKESNSRENNVAKIKVVVRKRPLNKKELSRKEDDVVSVCDNSLTVHEP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029177`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029177

Location Chr06:82534677-82539924 (-)

Description Similar to KIN13A: Kinesin-like protein KIN-13A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16630`	Internal motor kinesin involved in trichome morphogenesis.	An internal motor kinesin is associated with the Golgi apparatus and plays a role in trichome morphogenesis in Arabidopsis.2005 · DOI: 10.1091/mbc.e04-05-0400 AtKinesin-13A is located on Golgi-associated vesicle and involved in vesicle formation/budding in Arabidopsis root-cap peripheral cells.2009 · DOI: 10.1186/1471-2229-9-138 Rho of plant GTPase signaling regulates the behavior of Arabidopsis kinesin-13A to establish secondary cell wall patterns.2013 · DOI: 10.1105/tpc.113.117853 Atkinesin-13A modulates cell-wall synthesis and cell expansion in Arabidopsis thaliana via the THESEUS1 pathway.2014 · DOI: 10.1371/journal.pgen.1004627
`At3g16060`	Acts redundantly with KIN13A to modulate cell wall synthesis and cell expansion via the THE1 pathway.	Atkinesin-13A modulates cell-wall synthesis and cell expansion in Arabidopsis thaliana via the THESEUS1 pathway.2014 · DOI: 10.1371/journal.pgen.1004627

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0154700`	Kinesin-like protein KIN-13A.	No verified direct reference in this release
`Os01g0625200`	Kinesin-like protein KIN-13B.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029177 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007018 microtubule-based movement Biological Process

GO:0007019 microtubule depolymerization Biological Process

GO:0007080 mitotic metaphase chromosome alignment Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0030951 establishment or maintenance of microtubule cytoskeleton polarity Biological Process

GO:0051301 cell division Biological Process

GO:0051310 metaphase chromosome alignment Biological Process

GO:0051315 attachment of mitotic spindle microtubules to kinetochore Biological Process

GO:0051983 regulation of chromosome segregation Biological Process

GO:0090058 metaxylem development Biological Process

GO:0098696 regulation of neurotransmitter receptor localization to postsynaptic specialization membrane Biological Process

KEGG gene cross-reference

ath:AT3G16060

ath:AT3G16630

dosa:Os05g0154700

mmu:73804

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.655

Rank 1 · LXL04_029177 · OH-1004

Nucleus0.291

Rank 2 · LXL04_029177 · OH-1004

Cell membrane0.142

Rank 3 · LXL04_029177 · OH-1004

Lysosome / Vacuole0.058

Rank 4 · LXL04_029177 · OH-1004

Golgi apparatus0.058

Rank 5 · LXL04_029177 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796.12Microtub_bd224-367 aa

PF00225.30Kinesin231-568 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029177	`PF16796.12`	Microtub_bd	224	367	1.1e-14	55.3
LXL04_029177	`PF00225.30`	Kinesin	231	568	2.5e-97	326.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940B8`	Arabidopsis thaliana	Kinesin-like protein KIN-13A	67.788%	Swiss-Prot	strong database homology
`Q940Y8`	Arabidopsis thaliana	Kinesin-like protein KIN-13B	50.712%	Swiss-Prot	strong database homology
`B9FMJ3`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-13A	64.029%	Swiss-Prot	strong database homology
`B9EY52`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-13B	49.435%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card