LXL04_029169 | RubberDandelionOmics

Gene overview

LXL04_029169

Reference: OH-1004 Chr: Chr06 Coordinates: 82166514-82173417 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1083 bp · LXL04_029169|LXL04_029169|OH1004|cDNA

atggcacggagaccatactctagtactcttggatctttagctcatgctacaGTGGTTGTGTGCACAGGCCCGTTCACGATCAACTATACGAATTCCAGTTTTGAGAAGCCAAGGCTCGAGATAAACCCTCATAGTTGGACAAAGGCGGCCAACGTAATATTTCTTGATCAACCTGCTGGGTCTGGATTCTCCTATGCAAAAACTCCTGAAGCTTACATAACAAACGATACATTATCAACTATGCATGTTTACCATTTCTT...

CDS

Download CDS FASTA

1083 bp · LXL04_029169|LXL04_029169|OH1004|CDS

ATGGCACGGAGACCATACTCTAGTACTCTTGGATCTTTAGCTCATGCTACAGTGGTTGTGTGCACAGGCCCGTTCACGATCAACTATACGAATTCCAGTTTTGAGAAGCCAAGGCTCGAGATAAACCCTCATAGTTGGACAAAGGCGGCCAACGTAATATTTCTTGATCAACCTGCTGGGTCTGGATTCTCCTATGCAAAAACTCCTGAAGCTTACATAACAAACGATACATTATCAACTATGCATGTTTACCATTTCTT...

Protein

Download Protein FASTA

360 aa · LXL04_029169|LXL04_029169|OH1004|PROTEIN

MARRPYSSTLGSLAHATVVVCTGPFTINYTNSSFEKPRLEINPHSWTKAANVIFLDQPAGSGFSYAKTPEAYITNDTLSTMHVYHFLRKWLVDHPKFLNNPFYLGSDSYGGIVVPMIVHEIFNGNELRGWPHINIKVQIKGYVLGNPLTNTSGDNNSKIPFAHRMGLLSDAIYRSTKENCRGEYVDVDPDNKLCLHNLQVVDKEDNYLYSYTWANRRDVREALHIREEFNEIEWVRCNETLRSPDDNKTLSYTHSVQSSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029169`
TK1151 ID	TkA01G634870
OH-1004 ID	LXL04_029169
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	63.900
Protein coverage (%)	TK1151 100.000 / OH-1004 77.778 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029169

Location Chr06:82166514-82173417 (-)

Description Similar to SCPL18: Serine carboxypeptidase-like 18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g33540`	Probable carboxypeptidase.	No verified direct reference in this release
`At2g22980`	Catalyzes the formation of 1,2-bis-O-sinapoyl beta-D-glucoside.	Related Arabidopsis serine carboxypeptidase-like sinapoylglucose acyltransferases display distinct but overlapping substrate specificities.2007 · DOI: 10.1104/pp.107.098970
`At3g12203`	Probable carboxypeptidase.	No verified direct reference in this release
`At2g23010`	Catalyzes the formation of 1,2-bis-O-sinapoyl beta-D- glucoside and an unidentified compound 1.	Related Arabidopsis serine carboxypeptidase-like sinapoylglucose acyltransferases display distinct but overlapping substrate specificities.2007 · DOI: 10.1104/pp.107.098970
`At1g73300`	Probable carboxypeptidase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029169 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0019748 secondary metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004185 serine-type carboxypeptidase activity Molecular Function

GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function

GO:0016752 sinapoyltransferase activity Molecular Function

GO:0047158 sinapoylglucose-sinapoylglucose O-sinapoyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G33540

ath:AT1G73300

ath:AT2G22980

ath:AT2G23010

ath:AT3G12203

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.411

Rank 1 · LXL04_029169 · OH-1004

Extracellular0.221

Rank 2 · LXL04_029169 · OH-1004

Cytoplasm0.125

Rank 3 · LXL04_029169 · OH-1004

Cell membrane0.116

Rank 4 · LXL04_029169 · OH-1004

Endoplasmic reticulum0.113

Rank 5 · LXL04_029169 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450.29Peptidase_S1022-203 aa

PF00450.29Peptidase_S10209-357 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029169	`PF00450.29`	Peptidase_S10	22	203	1.1e-87	295.9
LXL04_029169	`PF00450.29`	Peptidase_S10	209	357	1.1e-87	295.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7Z9`	Arabidopsis thaliana	Serine carboxypeptidase-like 18	42.118%	Swiss-Prot	moderate database homology
`Q8H780`	Arabidopsis thaliana	Serine carboxypeptidase-like 13	42.382%	Swiss-Prot	moderate database homology
`Q9C7D6`	Arabidopsis thaliana	Serine carboxypeptidase-like 17	42.147%	Swiss-Prot	moderate database homology
`O64811`	Arabidopsis thaliana	Serine carboxypeptidase-like 9	42.623%	Swiss-Prot	moderate database homology
`Q9CAU3`	Arabidopsis thaliana	Serine carboxypeptidase-like 2	42.382%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card