LXL04_028938 | RubberDandelionOmics

Gene overview

LXL04_028938

Reference: OH-1004 Chr: Chr06 Coordinates: 75074849-75079172 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3726 bp · LXL04_028938|LXL04_028938|OH1004|cDNA

ATGGATACGAGTAACTGGAGGGGCCCTCAGGGTGGAAATGGGGCTATTGGTGACTCCTCTATGGAATCTGGTGATTGGAGGGCTCAACTACAAGCAGATTCGCGACAAAGAATCGTGAACAAAATAATGGATACCTTGAAGAGGCATCTTCCTTTCTCTGGGCATGAAGGGCTACAGGAACTTAAGAAAATAGCTGTTAGGTTTGAAGAGAAGATTTACACTGCTGCAACAAGTCAGTCTGATTATCTGCGGAAGATATC...

CDS

Download CDS FASTA

3726 bp · LXL04_028938|LXL04_028938|OH1004|CDS

ATGGATACGAGTAACTGGAGGGGCCCTCAGGGTGGAAATGGGGCTATTGGTGACTCCTCTATGGAATCTGGTGATTGGAGGGCTCAACTACAAGCAGATTCGCGACAAAGAATCGTGAACAAAATAATGGATACCTTGAAGAGGCATCTTCCTTTCTCTGGGCATGAAGGGCTACAGGAACTTAAGAAAATAGCTGTTAGGTTTGAAGAGAAGATTTACACTGCTGCAACAAGTCAGTCTGATTATCTGCGGAAGATATC...

Protein

Download Protein FASTA

1241 aa · LXL04_028938|LXL04_028938|OH1004|PROTEIN

MDTSNWRGPQGGNGAIGDSSMESGDWRAQLQADSRQRIVNKIMDTLKRHLPFSGHEGLQELKKIAVRFEEKIYTAATSQSDYLRKISLKMLTMETRSQNSMPEAMQANSGANSVNPSDPGSQVMQQVNSQGQPLPIPVPSNQNQQFLSQTMHNNMGSSGIQGSSSLSSALPPGAGLPQSSNVSSQNPTLQGIQNMSGSQQGNTMGPTNFANQRQIPGRQQPQQPQQQQQQPQQQQQQQNQNSHYAYQQQLQQMAKQKLQG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028938`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028938

Location Chr06:75074849-75079172 (-)

Description Similar to MED15A: Mediator of RNA polymerase II transcription subunit 15a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15780`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release
`At2g10440`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release
`At1g15770`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028938 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0045723 positive regulation of fatty acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016592 mediator complex Cellular Component

GO:0003713 transcription coactivator activity Molecular Function

GO:0031490 chromatin DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G15770

ath:AT1G15780

ath:AT2G10440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · LXL04_028938 · OH-1004

Cytoplasm0.143

Rank 2 · LXL04_028938 · OH-1004

Cell membrane0.015

Rank 3 · LXL04_028938 · OH-1004

Mitochondrion0.013

Rank 4 · LXL04_028938 · OH-1004

Endoplasmic reticulum0.007

Rank 5 · LXL04_028938 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16987.11KIX_224-101 aa

PF21539.3Med15_C1140-1212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028938	`PF16987.11`	KIX_2	24	101	4.9e-35	120.0
LXL04_028938	`PF21539.3`	Med15_C	1140	1212	2.3e-06	28.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I171`	Arabidopsis thaliana	Mediator of RNA polymerase II transcription subunit 15a	51.321%	Swiss-Prot	moderate database homology
`Q9SHV7`	Arabidopsis thaliana	Probable mediator of RNA polymerase II transcription subunit 15c	34.183%	Swiss-Prot	weak database homology
`F4I169`	Arabidopsis thaliana	Probable mediator of RNA polymerase II transcription subunit 15b	65.179%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card