LXL04_028935 | RubberDandelionOmics

Gene overview

LXL04_028935

Reference: OH-1004 Chr: Chr06 Coordinates: 75029281-75033015 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1908 bp · LXL04_028935|LXL04_028935|OH1004|cDNA

ATGGCGTCTGTGTCTTCCTTATCCATGTGCTTCTTTTCTGCTCATGCCCAAGCTCGCTCCAACAAACATCGTAAACAGCTTGTCCCCAAGAACCCTAATGCCAAAAAGTCCAACAGCATTACCACCCCACGTCCGCAGTCCCTTTTCTCCCTCTCCGGCGGCCAAGCTACAACCTACACTCGCCTGCCTCCCAAAGATGATGAATTCTCCGATTCCTTTGCAGAGATCAAGCTGTCCGATTTGGCAACACTGATGCATAT...

CDS

Download CDS FASTA

1908 bp · LXL04_028935|LXL04_028935|OH1004|CDS

ATGGCGTCTGTGTCTTCCTTATCCATGTGCTTCTTTTCTGCTCATGCCCAAGCTCGCTCCAACAAACATCGTAAACAGCTTGTCCCCAAGAACCCTAATGCCAAAAAGTCCAACAGCATTACCACCCCACGTCCGCAGTCCCTTTTCTCCCTCTCCGGCGGCCAAGCTACAACCTACACTCGCCTGCCTCCCAAAGATGATGAATTCTCCGATTCCTTTGCAGAGATCAAGCTGTCCGATTTGGCAACACTGATGCATAT...

Protein

Download Protein FASTA

635 aa · LXL04_028935|LXL04_028935|OH1004|PROTEIN

MASVSSLSMCFFSAHAQARSNKHRKQLVPKNPNAKKSNSITTPRPQSLFSLSGGQATTYTRLPPKDDEFSDSFAEIKLSDLATLMHMQKKPSSSSEDKIENDAELSDTEEDAGFDYGKFELFEVSSDEEIDGDEFEEDDLALENKGEDELGFEYKGEGEEEQEDEREKEKGVPAVMRCFDRAKIYVRSGDGGNGVVAFRREKFVPLGGPSGGDGGRGGNVYMEVDSSMNSLLPFRNSIHFRAGRGSHGQGSKMNGAKGDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028935`
TK1151 ID	TkA07G252000
OH-1004 ID	LXL04_028935
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028935

Location Chr06:75029281-75033015 (+)

Description Similar to OBGL: GTP-binding protein OBGC, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18570`	GTP-binding protein involved in membrane biogenesis and protein synthesis in chloroplast.	Arabidopsis OBG-like GTPase (AtOBGL) is localized in chloroplasts and has an essential function in embryo development.2009 · DOI: 10.1093/mp/ssp073

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0669200`	Probable GTP-binding protein that plays a crucial role in chloroplast development and is required for leaf greening during plant growth.	No verified direct reference in this release
`UniProt: A2YPR8`	Probable GTP-binding protein that may play a role in chloroplast development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028935 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006364 rRNA processing Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

KEGG gene cross-reference

ath:AT5G18570

csc:Csac_1571

dosa:Os07g0669200

sth:STH432

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.896

Rank 1 · LXL04_028935 · OH-1004

Mitochondrion0.094

Rank 2 · LXL04_028935 · OH-1004

Nucleus0.055

Rank 3 · LXL04_028935 · OH-1004

Cytoplasm0.040

Rank 4 · LXL04_028935 · OH-1004

Cell membrane0.017

Rank 5 · LXL04_028935 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01018.29GTP1_OBG180-337 aa

PF01926.30MMR_HSR1341-460 aa

PF02421.25FeoB_N341-500 aa

PF09269.17DUF1967542-611 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028935	`PF01018.29`	GTP1_OBG	180	337	2.8e-54	183.6
LXL04_028935	`PF01926.30`	MMR_HSR1	341	460	3.2e-23	82.7
LXL04_028935	`PF02421.25`	FeoB_N	341	500	2.3e-09	37.7
LXL04_028935	`PF09269.17`	DUF1967	542	611	7.9e-21	74.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7L0`	Arabidopsis thaliana	GTP-binding protein OBGC, chloroplastic	59.275%	Swiss-Prot	strong database homology
`Q0D3S3`	Oryza sativa subsp. japonica	Probable GTP-binding protein OBGC1, chloroplastic	70.190%	Swiss-Prot	strong database homology
`A2YPR8`	Oryza sativa subsp. indica	Probable GTP-binding protein OBGC1, chloroplastic	70.190%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card