Gene Card
Gene overview
cDNA / CDS / Protein Sequences
555 bp · LXL04_028887|LXL04_028887|OH1004|cDNA
ATGGATAAGTGGGTTGTTGAAGTCAAACGTGGTGAAACATTCAATGTTAACCTTGATGAAGGAAAGGGCTTGCGCTTACTTAAGGCTCGCTTTTGTGGAGAAGAAAAAGGATCAAAGGATTATGTCTATTTGAAAGCAACAGTTGAAGACAAAATTTTTATTATAGGAACCCTATCTGAGATACGCACAGTACAAATCCTTGACTTATTCTTTGACAAGGATACCCAGATATCACATAACTGGAGAAACGGAAGCGTTTG...
306 bp · LXL04_028887|LXL04_028887|OH1004|CDS
ATGGATAAGTGGGTTGTTGAAGTCAAACGTGGTGAAACATTCAATGTTAACCTTGATGAAGGAAAGGGCTTGCGCTTACTTAAGGCTCGCTTTTGTGGAGAAGAAAAAGGATCAAAGGATTATGTCTATTTGAAAGCAACAGTTGAAGACAAAATTTTTATTATAGGAACCCTATCTGAGATACGCACAGTACAAATCCTTGACTTATTCTTTGACAAGGATACCCAGATATCACATAACTGGAGAAACGGAAGCGTTTG...
Protein
Download Protein FASTA101 aa · LXL04_028887|LXL04_028887|OH1004|PROTEIN
MDKWVVEVKRGETFNVNLDEGKGLRLLKARFCGEEKGSKDYVYLKATVEDKIFIIGTLSEIRTVQILDLFFDKDTQISHNWRNGSVCFSGYIIDSTSDYGS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_028887 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_028887 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:73314400-73318447 (+) | |||||||||
| Description | Similar to HDT1: Histone deacetylase HDT1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006325 chromatin organization Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0009294 DNA-mediated transformation Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009944 polarity specification of adaxial/abaxial axis Biological Process GO:0010162 seed dormancy process Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0048364 root development Biological Process GO:0005634 nucleus Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G44750 ath:AT5G03740 zma:542636 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF17800.8NPL4-93 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_028887 | PF17800.8 | NPL | 4 | 93 | 7.6e-09 | 36.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.