LXL04_026469 | RubberDandelionOmics

Gene overview

LXL04_026469

Reference: OH-1004 Chr: Chr05 Coordinates: 126876185-126878977 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2454 bp · LXL04_026469|LXL04_026469|OH1004|cDNA

ATGCAAACGCCGAAAGtgaagaagatgacgaggaGAATTGATGGTAGTGGAACAGGGGCATCTGATGATGTTTATAGAGTTTTCTTACAAGACGAAGCTCTCCACGCCAATGATATCCCAGGTAACATTAACATTGATGAGGAATTTGTGAGGAACTTTGACATATTAGATGAGTTTGGAGTGGAAGAATCAATACCGATGAATGAAAATAGGAATCAGGAACCTAAAAGTGATAGTGACTATGAGGGTGACCATGAAGA...

CDS

Download CDS FASTA

2325 bp · LXL04_026469|LXL04_026469|OH1004|CDS

ATGCAAACGCCGAAAGTGAAGAAGATGACGAGGAGAATTGATGGTAGTGGAACAGGGGCATCTGATGATGTTTATAGAGTTTTCTTACAAGACGAAGCTCTCCACGCCAATGATATCCCAGGTAACATTAACATTGATGAGGAATTTGTGAGGAACTTTGACATATTAGATGAGTTTGGAGTGGAAGAATCAATACCGATGAATGAAAATAGGAATCAGGAACCTAAAAGTGATAGTGACTATGAGGGTGACCATGAAGA...

Protein

Download Protein FASTA

774 aa · LXL04_026469|LXL04_026469|OH1004|PROTEIN

MQTPKVKKMTRRIDGSGTGASDDVYRVFLQDEALHANDIPGNINIDEEFVRNFDILDEFGVEESIPMNENRNQEPKSDSDYEGDHEDSDFFIDEDNIIEDVEVDMEDFYMNTDTGAETNELSNEAEDIEVIDNDEFDSLSDDSRDTRRRKLLKELGKQKVCSEGEVHNVAFHIGQKYRTKKELKDKVDMHALKTKRSIFFKKNDKSRLTAVCTGTVIGNASGIQCPWRLHASRSTVEDYWFIKTYKQTHSCLNTRKVRSC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026469`
TK1151 ID	TkA08G115830
OH-1004 ID	LXL04_026469
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	86.600
Protein coverage (%)	TK1151 91.209 / OH-1004 97.158 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026469

Location Chr05:126876185-126878977 (+)

Description Similar to FRS6: Protein FAR1-RELATED SEQUENCE 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g52520`	Putative transcription activator involved in regulating light control of development.	Arabidopsis FHY3/FAR1 gene family and distinct roles of its members in light control of Arabidopsis development.2004 · DOI: 10.1104/pp.104.052191

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026469 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G52520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961

Rank 1 · LXL04_026469 · OH-1004

Cytoplasm0.093

Rank 2 · LXL04_026469 · OH-1004

Cell membrane0.021

Rank 3 · LXL04_026469 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_026469 · OH-1004

Mitochondrion0.013

Rank 5 · LXL04_026469 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03108.21DBD_Tnp_Mut169-235 aa

PF10551.16MULE378-473 aa

PF00872.25Transposase_mut393-520 aa

PF04434.23SWIM627-655 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026469	`PF03108.21`	DBD_Tnp_Mut	169	235	2.5e-10	40.6
LXL04_026469	`PF10551.16`	MULE	378	473	2.7e-20	73.2
LXL04_026469	`PF00872.25`	Transposase_mut	393	520	1.2e-06	28.4
LXL04_026469	`PF04434.23`	SWIM	627	655	1.7e-09	37.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSQ4`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 6	23.581%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card