LXL04_026171 | RubberDandelionOmics

Gene overview

LXL04_026171

Reference: OH-1004 Chr: Chr05 Coordinates: 122126319-122129416 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2262 bp · LXL04_026171|LXL04_026171|OH1004|cDNA

ATGGCTTCTTGCTTAGCAAAAAGTGTCTGCCTCTTTGGTTGGAACATCGGCAAAAACAAAACCAACGAGAAACCTCAGCCCAATTACCATAATGTTGATCTTCCTTTTCCATCTTTTCTACTCAACAAAACTTTCCTCAATGGGAAAGAATTAAAATGCTGTTACAAGGCCACCTTGGATGGATTTAGTGCGACTAAATTTCACGAATGTAGTGATTTCAAGGGCCCATGTGTGATTATCGGCTACACAGACAACTCGTT...

CDS

Download CDS FASTA

2262 bp · LXL04_026171|LXL04_026171|OH1004|CDS

ATGGCTTCTTGCTTAGCAAAAAGTGTCTGCCTCTTTGGTTGGAACATCGGCAAAAACAAAACCAACGAGAAACCTCAGCCCAATTACCATAATGTTGATCTTCCTTTTCCATCTTTTCTACTCAACAAAACTTTCCTCAATGGGAAAGAATTAAAATGCTGTTACAAGGCCACCTTGGATGGATTTAGTGCGACTAAATTTCACGAATGTAGTGATTTCAAGGGCCCATGTGTGATTATCGGCTACACAGACAACTCGTT...

Protein

Download Protein FASTA

753 aa · LXL04_026171|LXL04_026171|OH1004|PROTEIN

MASCLAKSVCLFGWNIGKNKTNEKPQPNYHNVDLPFPSFLLNKTFLNGKELKCCYKATLDGFSATKFHECSDFKGPCVIIGYTDNSFKFGAFNPEGYRSTDDYYETFDAFLFYWANNEDNVPIVLPKVGGSGAALFDYARGGPQFGADGLLIGPPLAPVMGGFAGPDTNSGVGDLKQAKSRLGLSYAKREDGKESLFGDEPRASLEEVLGVCMKIVPKSKPLIRRSHKSLSLSIPVNILPTPPHLHHRPAMAVSAFTPIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026171`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026171

Location Chr05:122126319-122129416 (+)

Description Similar to ABCI7: Protein ABCI7, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32500`	Protein ABCI7, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026171 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:1990229 iron-sulfur cluster assembly complex Cellular Component

GO:0046872 metal ion binding Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT1G32500

ecj:JW1671

eco:b1681

ecoc:C3026_09630

pfa:PF3D7_1103400

syn:slr0076

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.959

Rank 1 · LXL04_026171 · OH-1004

Cytoplasm0.061

Rank 2 · LXL04_026171 · OH-1004

Mitochondrion0.057

Rank 3 · LXL04_026171 · OH-1004

Nucleus0.032

Rank 4 · LXL04_026171 · OH-1004

Peroxisome0.030

Rank 5 · LXL04_026171 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07534.23TLD44-147 aa

PF19295.6SufBD_N312-465 aa

PF01458.24SUFBD_core483-711 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026171	`PF07534.23`	TLD	44	147	6e-10	40.0
LXL04_026171	`PF19295.6`	SufBD_N	312	465	5.4e-08	33.4
LXL04_026171	`PF01458.24`	SUFBD_core	483	711	1.5e-67	228.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LQK7`	Arabidopsis thaliana	Protein ABCI7, chloroplastic	59.877%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card